PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676715008 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 200aa MW: 23534.2 Da PI: 6.1541 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 71.3 | 8.2e-23 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krie +nrq+t+skR++g++KKA+ELS+LCd++ a+++fs++++l +s 676715008 9 KRIEKITNRQITYSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCLFS 58 79*****************************************9997765 PP | |||||||
2 | K-box | 21.4 | 1e-08 | 114 | 186 | 11 | 83 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 +++ e+l+qe+ +L+++++ ++e+R + + L s++e+++ e++L + l ++ ++K++ll + e k 676715008 114 HSDVEELEQEVCRLQQQLRISESELRIFEPDPLRFTSMEEMEHCETHLLNTLARVVQRKEHLLSRPCEAPSTK 186 567899*********************************************************9877765555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.9E-30 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.142 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.76E-27 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-21 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.1E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MGRGKLELKR IEKITNRQIT YSKRKKGLIK KAYELSTLCD IDLALLMFSP SDRLCLFSGQ 60 TRIQDVFARY INLPDQEREK GIQNKEYLLR TLEQLETENS MALQINELRP ECIHSDVEEL 120 EQEVCRLQQQ LRISESELRI FEPDPLRFTS MEEMEHCETH LLNTLARVVQ RKEHLLSRPC 180 EAPSTKQSME KILLKDVVEN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-14 | 1 | 78 | 1 | 79 | MEF2C |
5f28_B | 2e-14 | 1 | 78 | 1 | 79 | MEF2C |
5f28_C | 2e-14 | 1 | 78 | 1 | 79 | MEF2C |
5f28_D | 2e-14 | 1 | 78 | 1 | 79 | MEF2C |
6byy_A | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 2e-14 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676715008 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189414 | 5e-59 | AC189414.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB061K11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020889727.1 | 1e-112 | agamous-like MADS-box protein AGL66 | ||||
Refseq | XP_022544991.1 | 1e-113 | agamous-like MADS-box protein AGL104 isoform X3 | ||||
Swissprot | Q1PFC2 | 5e-82 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
Swissprot | Q9LM46 | 5e-82 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | D7KV59 | 1e-111 | D7KV59_ARALL; Transcription factor | ||||
TrEMBL | D7KXQ3 | 1e-111 | D7KXQ3_ARALL; Transcription factor | ||||
STRING | fgenesh2_kg.2__2089__AT1G77950.1 | 1e-112 | (Arabidopsis lyrata) | ||||
STRING | fgenesh2_kg.2__2429__AT1G77950.2 | 1e-112 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2179 | 23 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77950.2 | 1e-112 | AGAMOUS-like 67 |
Publications ? help Back to Top | |||
---|---|---|---|
|