PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011102237.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 261aa MW: 30572.9 Da PI: 8.6612 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86 | 2.1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr+g++KK +ELSvLCda++ +i+fss+g+l ey++ XP_011102237.1 9 KRIENNTSRQVTFSKRRAGLMKKTHELSVLCDAQIGLIVFSSKGRLTEYCT 59 79***********************************************96 PP | |||||||
2 | K-box | 61.6 | 3.1e-21 | 92 | 173 | 14 | 95 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 +e+ ++el+++k+e+ nLq ++ +++G+dL+s +++eL qLeqqLe+s+ k+R++K +ll+eq+e+l++ e l++en+++ XP_011102237.1 92 NEQVYKELTRMKNETLNLQLSLQRYKGDDLSSVQFEELTQLEQQLEHSVHKVRARKFQLLHEQLENLKRTEVLLEKENQEMY 173 578899************************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.202 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.3E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.33E-44 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 5.23E-31 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.5E-20 | 92 | 175 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.745 | 92 | 184 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 261 aa Download sequence Send to blast |
MGRGKIEVKR IENNTSRQVT FSKRRAGLMK KTHELSVLCD AQIGLIVFSS KGRLTEYCTP 60 PLSMKQIIER YVKAKGVTIP DHNNRVGPPP YNEQVYKELT RMKNETLNLQ LSLQRYKGDD 120 LSSVQFEELT QLEQQLEHSV HKVRARKFQL LHEQLENLKR TEVLLEKENQ EMYHWLMSNQ 180 IQKQAELEQQ QQQQAMAMTE LKLVEQQQPL LQNHQQLPFF GDDLQLGNLP LHTVTHSSYR 240 LQPTHPNLQD HTHHHPPLPI E |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-17 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011102237.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011102237.1 | 0.0 | MADS-box protein defh21 | ||||
Refseq | XP_011102244.1 | 0.0 | MADS-box protein defh21 | ||||
Refseq | XP_011102249.1 | 0.0 | MADS-box protein defh21 | ||||
Swissprot | Q8RVL4 | 1e-127 | DEF21_ANTMA; MADS-box protein defh21 | ||||
TrEMBL | A0A2Z7AN33 | 1e-132 | A0A2Z7AN33_9LAMI; Uncharacterized protein | ||||
STRING | Migut.C01064.1.p | 1e-136 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 7e-56 | MIKC_MADS family protein |