PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011102212.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 124aa MW: 13792.6 Da PI: 4.4888 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 84.9 | 1.1e-26 | 1 | 72 | 30 | 101 |
DUF260 30 fanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 f +h++FGasn++kll++lpe +r da++s+vyeA+ar+rdP+yG++g+i +lq+q+++l+ae+a++++e+ XP_011102212.1 1 FITAHRVFGASNIIKLLQELPEAQRADAVNSMVYEANARLRDPIYGCTGMICHLQSQVSELQAEVAKAQAEI 72 5689***************************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 8.3E-26 | 1 | 69 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 16.417 | 1 | 72 | IPR004883 | Lateral organ boundaries, LOB |
Gene3D | G3DSA:1.20.58.60 | 2.0E-4 | 23 | 122 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
FITAHRVFGA SNIIKLLQEL PEAQRADAVN SMVYEANARL RDPIYGCTGM ICHLQSQVSE 60 LQAEVAKAQA EILNMQCQNA SLIDLLCKGM AGTQNVEENL IYDHNSTIFS DEPNVGVSWE 120 HLWT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-24 | 1 | 77 | 40 | 116 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-24 | 1 | 77 | 40 | 116 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011102212.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011102212.1 | 3e-89 | LOB domain-containing protein 1-like, partial | ||||
Swissprot | Q9LQR0 | 1e-43 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | A0A4D9AES9 | 3e-58 | A0A4D9AES9_SALSN; Uncharacterized protein | ||||
STRING | Migut.F02029.1.p | 3e-56 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 5e-46 | LOB domain-containing protein 1 |