PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011101908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB
Protein Properties Length: 309aa    MW: 35161.1 Da    PI: 9.9571
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011101908.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-181964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
   XP_011101908.1 19 RGHWRPAEDEKLRQLVQQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 64
                     899*****************************.***********996 PP

2Myb_DNA-binding57.72.6e-1871114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
   XP_011101908.1  71 RRPFSEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 114
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2431465IPR017930Myb domain
SuperFamilySSF466892.81E-2918112IPR009057Homeodomain-like
SMARTSM007175.7E-151867IPR001005SANT/Myb domain
PfamPF002491.2E-171964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-272072IPR009057Homeodomain-like
CDDcd001672.35E-142263No hitNo description
PROSITE profilePS5129427.38866120IPR017930Myb domain
SMARTSM007171.2E-1570118IPR001005SANT/Myb domain
PfamPF002493.3E-1571113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2173119IPR009057Homeodomain-like
CDDcd001671.48E-782113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDDQTTCGGS NDDPRTCPRG HWRPAEDEKL RQLVQQYGPQ NWNSIAEKLQ GRSGKSCRLR  60
WFNQLDPRIN RRPFSEEEEE RLLAAHRIHG NKWALISRLF PGRTDNAVKN HWHVIMARKQ  120
REKSKLCGSK RTTLDQDNYN VALPHSKSPT TYIFRRKNSR LQEDHDPFGS KISFENGGIL  180
DLHSQSKDKI FSMSSFSGSY TPWPNNLSPD LFGTKSYKSP SSASIGSNHQ TNFSIFSPNE  240
DSVSALNNKR TLSNTFSCLD YGSKINRDFS SIGENSLPFG KTRTSVNQQQ LEEKKNVPFI  300
DFLGVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31191197107B-MYB
1gv2_A6e-31191194104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-301911958158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-301911958158MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-31191194104C-Myb DNA-Binding Domain
1msf_C6e-31191194104C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011101908.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594591e-115KF059459.1 Salvia miltiorrhiza MYB-related transcription factor (MYB105) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101908.10.0transcription factor MYB27
RefseqXP_020554996.10.0transcription factor MYB27
TrEMBLA0A2G9H6B41e-136A0A2G9H6B4_9LAMI; Transcription factor, Myb superfamily
STRINGMigut.C01099.1.p1e-109(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-64myb domain protein 52