PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 535aa    MW: 59496.8 Da    PI: 5.4926
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097791.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.19.3e-1361655341373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+e L++cA+ v+++dl   + ++++l+ ++s  g+p+qRl ay++e+L arl++s+s++ykal+++e +   s e l++++l++e++P++kf++
  XP_011097791.1 165 LKEMLVACAKSVADNDLFTSELFMSELRLMVSVCGEPLQRLGAYMLEGLVARLSSSGSSIYKALRCKEPT---SPELLSYMHLLYEICPYFKFGY 256
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     l aN aI ea+++e+r+HiiDf+i qG QW++L+qaLa+Rp+gpp++RiTgv++p s   +   le +g+rL+++A+++gvpfef+ l a +  d
  XP_011097791.1 257 LSANGAIAEAMKNETRIHIIDFQIAQGSQWITLIQALATRPGGPPQMRITGVDDPVSAyaRGGGLEIVGQRLSRLAKSCGVPFEFHGL-AISGCD 350
                     *******************************************************99999999************************6.777899 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     le ++L+++ gEal+Vn++++lh+++desvs+e++rd++L++vk+lsPkvv++veqe+++n+++F+ rf+e+leyy a+f+s+++ l+re++eri
  XP_011097791.1 351 LERKHLKIQAGEALVVNFAMMLHHMPDESVSIENHRDRLLRMVKNLSPKVVTLVEQESNTNTAPFVLRFIETLEYYLAIFESIDVALSRENKERI 445
                     9********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +vE+++l+r+ivnv+aceg er+erhe lekWr+r+ +aGF+p pls+++++++k ll+++++  yr+ e +g+l+lgW++r+Lv+ +aW
  XP_011097791.1 446 NVEQHCLARDIVNVIACEGPERVERHELLEKWRRRFAMAGFSPFPLSSFVNSTIKNLLKNYSGS-YRLVEGDGCLYLGWMNRNLVASCAW 534
                     **************************************************************66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.015139516IPR005202Transcription factor GRAS
PfamPF035143.2E-133165534IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MTSQNHDNIA GSGRFVHQPL EELESYLLDP SCNLDHFISC DGESQGIQFP AEIYEQRCRV  60
DSSIASGSYS FYNSPSAVSF SSNVSSSTQP DCVSDTNNSI HDTRLSVSRA CSLDCENDLE  120
NKLGELRPLQ PILGPDSRGV GAGSQFSIEP QLSKEAMDII QCKNLKEMLV ACAKSVADND  180
LFTSELFMSE LRLMVSVCGE PLQRLGAYML EGLVARLSSS GSSIYKALRC KEPTSPELLS  240
YMHLLYEICP YFKFGYLSAN GAIAEAMKNE TRIHIIDFQI AQGSQWITLI QALATRPGGP  300
PQMRITGVDD PVSAYARGGG LEIVGQRLSR LAKSCGVPFE FHGLAISGCD LERKHLKIQA  360
GEALVVNFAM MLHHMPDESV SIENHRDRLL RMVKNLSPKV VTLVEQESNT NTAPFVLRFI  420
ETLEYYLAIF ESIDVALSRE NKERINVEQH CLARDIVNVI ACEGPERVER HELLEKWRRR  480
FAMAGFSPFP LSSFVNSTIK NLLKNYSGSY RLVEGDGCLY LGWMNRNLVA SCAWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-661675346374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011097791.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097791.10.0scarecrow-like protein 21 isoform X1
RefseqXP_011097792.10.0scarecrow-like protein 21 isoform X1
RefseqXP_011097793.10.0scarecrow-like protein 21 isoform X1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A4D9AKH10.0A0A4D9AKH1_SALSN; Uncharacterized protein
STRINGAET009250.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]