PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011096328.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 131aa MW: 15013.6 Da PI: 8.3889 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.9 | 1.2e-42 | 52 | 127 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqve+C+ad+++a+ yhrrhkvCe+h+ka+vv+++gl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++ XP_011096328.1 52 CQVEDCTADMADARPYHRRHKVCEFHAKAAVVFLAGLQQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 127 **************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 8.1E-57 | 1 | 131 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 2.5E-34 | 44 | 113 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.137 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.53E-38 | 51 | 129 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.5E-32 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
METSKEAGKR IAELDEEGEE DEDAGEDNKK KRALSPSKRR VSGAGGSTQR SCQVEDCTAD 60 MADARPYHRR HKVCEFHAKA AVVFLAGLQQ RFCQQCSRFH ELQEFDEAKR SCRRRLAGHN 120 ERRRKSSYDS H |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-42 | 44 | 125 | 3 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011096328.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011096328.1 | 2e-91 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q38741 | 1e-65 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A075FJ68 | 2e-67 | A0A075FJ68_SALMI; SQUAMOSA promoter binding protein-like 15 (Fragment) | ||||
STRING | Migut.M01124.1.p | 5e-56 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 1e-45 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|