PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011095997.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25699.4 Da PI: 10.1036 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.4 | 2.9e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++yey+ XP_011095997.1 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 105.9 | 4.7e-35 | 80 | 173 | 8 | 100 |
K-box 8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++e +a+ +qqe++kL+++i++Lq+++Rhl+Ge+L+sL++keL+qLe++Le+++++iR kK+el+l+++e+lqk+e +l++en +Lr+k++e XP_011095997.1 80 YtTQEINAQFYQQESKKLRQQIQMLQSSNRHLMGESLGSLNVKELKQLESRLERGITRIRGKKHELILAETENLQKREIQLEQENACLRAKIQE 173 2478999************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.978 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.46E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 3.79E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.7E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.7E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.7E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.7E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.4E-27 | 83 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.074 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEYANN 60 NIRSTIDRYK KATADSSNAY TTQEINAQFY QQESKKLRQQ IQMLQSSNRH LMGESLGSLN 120 VKELKQLESR LERGITRIRG KKHELILAET ENLQKREIQL EQENACLRAK IQENEKLQQL 180 SMMPSGQDFA FQAYLARNVL QLNMMENVTA YPVPDKKTLH LG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011095997.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095997.1 | 1e-163 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_011096010.1 | 1e-163 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_011096018.1 | 1e-163 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_011096026.1 | 1e-163 | agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-119 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A2G9H1Q5 | 1e-155 | A0A2G9H1Q5_9LAMI; MADS box transcription factor | ||||
STRING | Migut.C01334.1.p | 1e-140 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-103 | MIKC_MADS family protein |