PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011095941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 552aa    MW: 61289.8 Da    PI: 6.0617
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011095941.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.61.8e-1261725521374
            GRAS   1 lvelLlecAeavssgdle..........laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                     l++lL++cAe vs+ d+           +a+al++ l++++s +g+p+qRl ay++e+L+arl++s+s +yk+l+++e +   sse ++++++++
  XP_011095941.1 172 LKQLLVACAEIVSEADTIsfsdrqvavsAAEALMEILEKQVSVSGEPLQRLGAYMLEGLRARLLSSGSIIYKKLKCKEPT---SSELMSYMHVLY 263
                     5799********996653333444666699999**********************************************9...99********** PP

            GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                     +++P++kf+++ aN  I ea+e+e+r+H+iDf+i qG QW++++qaL+ R++gpp +RiTg+++++s   +   l  +g+rLa++A+++gvpfef
  XP_011095941.1 264 QICPYYKFAYMSANVVIGEAMENENRIHVIDFQIAQGSQWVSFIQALSRRAGGPPYIRITGIDDAQSAhaRGGGLDLVGQRLAQVAKSCGVPFEF 358
                     ****************************************************************9998889999********************* PP

            GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                     +  +a +  d++le+L+v++gEalaVn+ + lh+++desv++ ++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy+a+f+s++a
  XP_011095941.1 359 HG-AAMSGCDVQLENLQVRHGEALAVNFPYILHHMPDESVNTMNHRDRLLRLVKSLSPKVVTLVEQESNTNTSTFFQRFCETLDYYTAMFESIDA 452
                     **.8999**************************************************************************************** PP

            GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                       +re+++ri+ E+++++r++vn++aceg+er+erhe ++kWr rl++aGF+pv+ls ++   ++ +l++++s+ yr+ e +g+l+lgWk+r+L 
  XP_011095941.1 453 ARAREDRQRISAEEHCVARDVVNIIACEGTERVERHELFGKWRLRLMMAGFSPVQLSPSVGIAIRDMLKEYSSN-YRLAEGHGALYLGWKNRALA 546
                     99**********************************************************************77.******************** PP

            GRAS 369 svSaWr 374
                     + SaWr
  XP_011095941.1 547 TSSAWR 552
                     *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.054146533IPR005202Transcription factor GRAS
PfamPF035146.1E-124172552IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MQASQESETS SGFHSFYNRP VQQVEPYGIS TFQVLNNNST SSKSQGSGFS FQTYTEQFFT  60
LESTPATDFA AYNSPSAVSV SSSRSPFSPQ GSHSYGSDLH HSSDNTYGSP LSGSSGVEDE  120
NKLMHALWVL RNELLGPESD TDDSGSFNGI VTQPSPFTRY NRILEMAPHM DLKQLLVACA  180
EIVSEADTIS FSDRQVAVSA AEALMEILEK QVSVSGEPLQ RLGAYMLEGL RARLLSSGSI  240
IYKKLKCKEP TSSELMSYMH VLYQICPYYK FAYMSANVVI GEAMENENRI HVIDFQIAQG  300
SQWVSFIQAL SRRAGGPPYI RITGIDDAQS AHARGGGLDL VGQRLAQVAK SCGVPFEFHG  360
AAMSGCDVQL ENLQVRHGEA LAVNFPYILH HMPDESVNTM NHRDRLLRLV KSLSPKVVTL  420
VEQESNTNTS TFFQRFCETL DYYTAMFESI DAARAREDRQ RISAEEHCVA RDVVNIIACE  480
GTERVERHEL FGKWRLRLMM AGFSPVQLSP SVGIAIRDML KEYSSNYRLA EGHGALYLGW  540
KNRALATSSA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-5717955125377Protein SCARECROW
5b3h_D9e-5717955125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011095941.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095941.10.0scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A022QK740.0A0A022QK74_ERYGU; Uncharacterized protein
STRINGMigut.M01421.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13