PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB
Protein Properties Length: 308aa    MW: 35030.3 Da    PI: 8.8678
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094978.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a +++ ++   +W+ +a++++ g+t  +++  ++ 
   XP_011094978.1 28 KWTPEENKRFENALALFDKDtpdRWHNVASMIP-GKTVSDVIKQYRE 73
                     8********************************.*******999986 PP

2Myb_DNA-binding46.48.8e-15135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_011094978.1 135 PWTEEEHRLFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 179
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.5462479IPR017884SANT domain
SMARTSM007175.1E-102577IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-42775IPR009057Homeodomain-like
PfamPF002494.3E-82874IPR001005SANT/Myb domain
CDDcd001672.21E-82875No hitNo description
SuperFamilySSF466894.02E-122882IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-13125184IPR009057Homeodomain-like
PROSITE profilePS5129421.477128184IPR017930Myb domain
SuperFamilySSF466892.24E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-18131183IPR006447Myb domain, plants
SMARTSM007172.8E-13132182IPR001005SANT/Myb domain
PfamPF002493.2E-12135179IPR001005SANT/Myb domain
CDDcd001673.80E-11135180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNREMGLVSP ASYLSDSSWL FQEDTVTKWT PEENKRFENA LALFDKDTPD RWHNVASMIP  60
GKTVSDVIKQ YRELVEDVSD IEAGLIPIPG YTNNSFTLEW VSNHGYEGLK QLYGPGGKRN  120
SSTRCSDHER KKGVPWTEEE HRLFLLGLKK YGKGDWRNIS RNFVTTRTPT QVASHAQKYF  180
IRQLSGGKDK RRSSIHDITT VNLEETKSPS PEKDRPSRSP EKSNLIMQSP QNLDTDVVVR  240
ATYDSSLTNP GAVMGFSPAN SSLMITHLQG MYSFGLNLHE HRMQSIDSHA FRLGHHGTIF  300
QMHPTRHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1829911173RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011094978.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094978.10.0transcription factor DIVARICATA-like
SwissprotQ8S9H71e-111DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2G9I5K71e-176A0A2G9I5K7_9LAMI; Zuotin
STRINGPOPTR_0016s11980.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-102MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]