PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011091774.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 249aa MW: 28117.2 Da PI: 9.774 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87 | 1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien rqvtfskRr+g++KKA+ELSvLC+a+vaviifs+tgk++++ss XP_011091774.1 9 KKIENANSRQVTFSKRRAGLFKKAYELSVLCEADVAVIIFSNTGKVFDFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 62.9 | 1.2e-21 | 78 | 172 | 6 | 100 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 g ++e++ +++ +e++ Lk+eie+L+ +q ++lG+d + +sl++L+ LeqqL+++l i+++K++ll++q+ +++ +e+++ en++Lrk++ee XP_011091774.1 78 GPAVEQKPEKQQPKEVDVLKEEIEKLKLKQLRFLGKDFTGMSLQDLRALEQQLNEGLLCIKERKEQLLMQQLAQSRVQEQRAVLENETLRKQVEE 172 45566777778889******************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.833 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.06E-42 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 5.23E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.7E-16 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.266 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010047 | Biological Process | fruit dehiscence | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
GO:0060862 | Biological Process | negative regulation of floral organ abscission | ||||
GO:0060867 | Biological Process | fruit abscission | ||||
GO:0071365 | Biological Process | cellular response to auxin stimulus | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MGRGKIEIKK IENANSRQVT FSKRRAGLFK KAYELSVLCE ADVAVIIFSN TGKVFDFSSS 60 SMKKILTRYK KCLELTQGPA VEQKPEKQQP KEVDVLKEEI EKLKLKQLRF LGKDFTGMSL 120 QDLRALEQQL NEGLLCIKER KEQLLMQQLA QSRVQEQRAV LENETLRKQV EELRTLFPST 180 SYASPLCIEF HSTVKKSNPV SKAGSRSPET ACNGRLEDED SDTTLHLGPP SGISRKRKTP 240 DGETHSSTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 233 | 238 | SRKRKT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00508 | DAP | Transfer from AT5G13790 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011091774.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011091774.1 | 0.0 | agamous-like MADS-box protein AGL15 | ||||
Swissprot | Q39295 | 1e-69 | AGL15_BRANA; Agamous-like MADS-box protein AGL15 | ||||
TrEMBL | A0A067L5A5 | 1e-115 | A0A067L5A5_JATCU; Uncharacterized protein | ||||
STRING | Migut.N01802.1.p | 1e-107 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA8775 | 22 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13790.1 | 1e-62 | AGAMOUS-like 15 |