PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB
Protein Properties Length: 509aa    MW: 55732.2 Da    PI: 5.6491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090254.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_011090254.1 39 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
   XP_011090254.1  92 KGAFTPEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5813486IPR017930Myb domain
SuperFamilySSF466893.11E-3037133IPR009057Homeodomain-like
SMARTSM007171.7E-133888IPR001005SANT/Myb domain
PfamPF002493.8E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-244093IPR009057Homeodomain-like
CDDcd001674.65E-114186No hitNo description
PROSITE profilePS5129426.47487141IPR017930Myb domain
SMARTSM007171.8E-1691139IPR001005SANT/Myb domain
PfamPF002491.4E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2694140IPR009057Homeodomain-like
CDDcd001673.60E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MSMTSESDER MMPNNGVDSP SVDDANSGGN VGGNGPLKKG PWTSAEDAIL VEYVTKHGEG  60
NWNAVQKHSG LARCGKSCRL RWANHLRPDL KKGAFTPEEE RRIIELHAKM GNKWARMAAE  120
LPGRTDNEIK NYWNTRIKRR QRAGLPIYPP DICMQAMTEK QPSDNMNTFS SAEVHHPDFM  180
PVNNFEIPAV EFKNLELNQQ LYSPALLDIP AGSLLDIPAS SLLAQGLHSS YPNKSLLSTV  240
HPSKRLRGSE SFFPSLNTAI GNALTGGSQY QSDGSLQIAQ SFVYSSPYDH SSTSDHATSS  300
SLIPGSHAVL NGTPSSEPAW AMKLELPSLQ TQMGSWGSPS PSSPLPCFES VDILIQTPPT  360
EHTQSCNLSP QNSGLLDAVL YESETMKNSK IDDCQHTSRA STVEAAMMAN STHDLHETEW  420
EAYDEQLSPL GHSSSSVFSG NSLDDLHSAE TMPGCRIKEA SNLGLMQYDE KVETTNQMIF  480
SRPDFLLASN CFAPMKHPSK DHSLLKDAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32371405107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011090254.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090254.10.0transcription factor GAMYB-like
TrEMBLA0A2G9GLK00.0A0A2G9GLK0_9LAMI; Transcription factor, Myb superfamily
STRINGXP_009786742.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.15e-90myb domain protein 33