PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011087945.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 221aa MW: 24742.2 Da PI: 10.0838 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.7 | 5.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCdae+a+i+fs tgkl++yss XP_011087945.1 9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSATGKLFDYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 53.5 | 1e-18 | 79 | 170 | 8 | 98 |
K-box 8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ +++s + ++ak+ ke+ L e+++l+Ge+L+ L + +L++Le+ +e++l+++ ++Kn+ ll++i++l+ +e el en +L+++ XP_011087945.1 79 PgQQPLHTQSGSSNHAKISKELGDLTLELKQLMGEELQGLGMSDLMKLEKLVETGLNRVGKTKNDKLLSEISKLKTRESELMAENARLKQEA 170 34777889999*****************************************************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.212 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.4E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.98E-38 | 3 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.03E-28 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.2E-15 | 85 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.744 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD AEIALIVFSA TGKLFDYSSS 60 SMMQLIQRHS LQSEKSNKPG QQPLHTQSGS SNHAKISKEL GDLTLELKQL MGEELQGLGM 120 SDLMKLEKLV ETGLNRVGKT KNDKLLSEIS KLKTRESELM AENARLKQEA NQRQKLGCAR 180 NGMEQGNSAE SITNFHQDLV HRPDEDSDTS LKLGLPFSNG N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 3e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 3e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 3e-19 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011087945.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011087945.1 | 1e-160 | MADS-box protein SVP isoform X1 | ||||
Refseq | XP_020551408.1 | 1e-160 | MADS-box protein SVP isoform X1 | ||||
Refseq | XP_020551409.1 | 1e-160 | MADS-box protein SVP isoform X1 | ||||
Swissprot | Q9FVC1 | 3e-70 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A2G9GMI4 | 1e-121 | A0A2G9GMI4_9LAMI; MADS box transcription factor | ||||
STRING | Migut.B00557.1.p | 1e-106 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-72 | MIKC_MADS family protein |