PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_011086823.1

Organism

Sesamum indicum

Taxonomic ID

4182

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum

Family

MIKC_MADS

Protein Properties

Length: 185aa MW: 20747.1 Da PI: 9.6685

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_011086823.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.1	1.1e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ks rqvtf+kRr+g+lKKA+ELSvLCd++v viifss+gkly y+s XP_011086823.1 9 KRIEDKSARQVTFTKRRKGLLKKAKELSVLCDVDVGVIIFSSRGKLYHYCS 59 79***********************************************96 PP
2	K-box	46.8	1.3e-16	88	159	14	85
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 +++ + +++ L k e Lq R l ++++L++k+L +Le+qLe++l +iR++K++lll++i++l +k XP_011086823.1 88 QQEAKSKYTGLLKSGELLQIVDRELGETCVNNLTVKDLVHLEKQLEDALIQIRATKTHLLLDSISNLHEKIA 159 56777888899999******999999***************************************99865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.5E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.347	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.38E-37	2	73	No hit	No description
SuperFamily	SSF55455	5.1E-31	2	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-26	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.0E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-26	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.9E-12	87	158	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	10.026	88	185	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MGRRKLEIKR IEDKSARQVT FTKRRKGLLK KAKELSVLCD VDVGVIIFSS RGKLYHYCST 60 NSLTEILQQY QNCVAMGPGA QTAVRGMQQE AKSKYTGLLK SGELLQIVDR ELGETCVNNL 120 TVKDLVHLEK QLEDALIQIR ATKTHLLLDS ISNLHEKIAG SKADGRTNKM IMDLNVIADS 180 QMTEQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	9e-20	1	70	1	69	MEF2C
5f28_B	9e-20	1	70	1	69	MEF2C
5f28_C	9e-20	1	70	1	69	MEF2C
5f28_D	9e-20	1	70	1	69	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_011086823.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011086823.1	1e-133	MADS-box transcription factor 7-like isoform X3
Swissprot	P0C5B0	3e-41	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	3e-41	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A1S3X7B1	1e-59	A0A1S3X7B1_TOBAC; agamous-like MADS-box protein AGL27 isoform X1
TrEMBL	A0A1U7XSL9	1e-59	A0A1U7XSL9_NICSY; agamous-like MADS-box protein AGL27 isoform X1
STRING	XP_009795052.1	2e-60	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	2e-42	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]