PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB
Protein Properties Length: 219aa    MW: 24842.7 Da    PI: 9.0108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084236.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45e-112369448
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     W+ +Ed+++ +a  +++ g   +W++Ia+ ++ g+++ ++++++ ++l
   XP_011084236.1 23 WSRQEDKIFEKALVEFPEGidhRWRRIAEFLP-GKSPDEVRLHYETLL 69
                     ********************************.***********9875 PP

2Myb_DNA-binding422.1e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_011084236.1 126 PWTEDEHRLFLIGLDRYGKGDWRSISRNVVVTRTPTQVASHAQKY 170
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.1121573IPR017930Myb domain
SMARTSM007175.0E-101971IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-112276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-72370IPR009057Homeodomain-like
CDDcd001672.61E-102369No hitNo description
PfamPF002496.2E-102369IPR001005SANT/Myb domain
PROSITE profilePS5129417.826119175IPR017930Myb domain
SuperFamilySSF466891.93E-16121175IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-17122173IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-10123169IPR009057Homeodomain-like
SMARTSM007178.2E-10123173IPR001005SANT/Myb domain
CDDcd001671.33E-8126171No hitNo description
PfamPF002492.3E-11126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MYGIDANSNR WTPPAVDSAA AVWSRQEDKI FEKALVEFPE GIDHRWRRIA EFLPGKSPDE  60
VRLHYETLLH DIAEIDSGRV ELPSYSDESA PLGWDQHARP RTPGQISFGG GNRSRHSEVE  120
RKKGTPWTED EHRLFLIGLD RYGKGDWRSI SRNVVVTRTP TQVASHAQKY FLRHNSGKKE  180
RKRSSIHDIT TAMDSMPVPA PTNLPNQGGS QNCSFAMPR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011084236.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084236.11e-163transcription factor SRM1-like
SwissprotQ9FNN65e-58SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2G9IA531e-122A0A2G9IA53_9LAMI; Uncharacterized protein
STRINGMigut.F01593.1.p2e-98(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-74MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]