PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011082513.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 141aa MW: 15363.4 Da PI: 10.2822 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 26.1 | 1.8e-08 | 30 | 107 | 19 | 96 |
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdiv 96 ++P+ ri + lk+ + +isa aPv ls e++ el s a+++k++ + di+ av + d l+++v XP_011082513.1 30 LQFPVGRIARFLKVGNYSDRISAGAPVYLSAVLEYLAAELLELSGDSAKDSKKNRIVPRDIELAVRNDDELSRLLERV 107 589***************************************************************999888887766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00125 | 7.8E-15 | 7 | 95 | IPR007125 | Histone H2A/H2B/H3 |
SMART | SM00414 | 6.2E-62 | 9 | 129 | IPR002119 | Histone H2A |
Gene3D | G3DSA:1.10.20.10 | 1.8E-49 | 13 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.45E-37 | 13 | 126 | IPR009072 | Histone-fold |
CDD | cd00074 | 1.93E-54 | 14 | 125 | No hit | No description |
PRINTS | PR00620 | 3.2E-40 | 20 | 42 | IPR002119 | Histone H2A |
PROSITE pattern | PS00046 | 0 | 28 | 34 | IPR032458 | Histone H2A conserved site |
PRINTS | PR00620 | 3.2E-40 | 49 | 64 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 3.2E-40 | 64 | 77 | IPR002119 | Histone H2A |
PRINTS | PR00620 | 3.2E-40 | 92 | 104 | IPR002119 | Histone H2A |
Pfam | PF16211 | 4.0E-9 | 98 | 129 | IPR032454 | Histone H2A, C-terminal domain |
PRINTS | PR00620 | 3.2E-40 | 106 | 124 | IPR002119 | Histone H2A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000786 | Cellular Component | nucleosome | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MRTTATASTK GSRGKSKASK YVSRSSKAGL QFPVGRIARF LKVGNYSDRI SAGAPVYLSA 60 VLEYLAAELL ELSGDSAKDS KKNRIVPRDI ELAVRNDDEL SRLLERVTIP YAGVTPHIHH 120 FLYPKSNEGR DGEIGSGSQQ L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5oy7_e | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
5x0x_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
5x0x_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6ftx_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6ftx_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6g0l_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6i84_Q | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6i84_V | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6j99_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6j99_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6n1z_B | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6n1z_E | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6ne3_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6ne3_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A type 1 |
6o96_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6o96_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6om3_C | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6om3_G | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6om3_O | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
6om3_S | 3e-48 | 8 | 128 | 2 | 122 | Histone H2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011082513.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082513.1 | 1e-98 | histone H2AX-like | ||||
Swissprot | O65759 | 2e-63 | H2AX_CICAR; Histone H2AX | ||||
TrEMBL | A0A2Z7DAP6 | 4e-65 | A0A2Z7DAP6_9LAMI; Histone H2A | ||||
STRING | XP_004494649.1 | 2e-62 | (Cicer arietinum) | ||||
STRING | AES82099 | 3e-62 | (Medicago truncatula) |