PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 491aa    MW: 55011.5 Da    PI: 6.0853
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080617.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS446.12.3e-136664861374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl cA++v++g+ e+a+ +L+ +s+lasp+gd+mqR+aayfteALa r+++ +++l kal++++t+  +++ee+ ++klf+e +P+lk+s+
  XP_011080617.1  66 LIHLLLVCANHVAAGSIENANICLECISHLASPAGDTMQRIAAYFTEALADRILKGWPGLHKALNSTKTT--SVAEEILVHKLFYEFCPFLKLSY 158
                     689*************************************************************999998..5********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +++NqaIlea+ege+ vHiiD++  +++QW++Ll+aL++Rp+gpp++RiTgv++    ++e l ++++rL++ Ae+l++ f+fn+ ++++le+l+
  XP_011080617.1 159 VITNQAILEAMEGEKVVHIIDLNCFEPTQWISLLRALSARPDGPPHVRITGVHE----QNEVLDQMAHRLNEEAEKLDILFQFNP-IVSKLENLD 248
                     ******************************************************....9**************************.7999***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll..........................................................desvsles.erde 226
                     +++L vk+gEa+aV++vlqlh+ll                                                          +      s + ++
  XP_011080617.1 249 VKSLCVKTGEAVAVSSVLQLHSLLavnhemtqmdspylskspctlqrvlqtnpctlgeflekdvinacsaspdsassspiysAP-----SpKMTS 338
                     ************************************************************************997765533222.....144678 PP

            GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                     +L ++ +lsP+++vv+eqe++hn+ ++ +r++eal++y+alfd+le+++pr+s er+k+E++l+g+ei+n++aceg +r++rhe+l kW  rle 
  XP_011080617.1 339 FLYALCGLSPNLMVVTEQESNHNGFNLTDRITEALNFYAALFDCLESTMPRASIERQKIEKMLFGKEIKNIIACEGVDRTKRHEKLDKWIPRLEL 433
                     *********************************************************************************************** PP

            GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     aG+++vpls++a+ qa++ll+  + +gy++++e+ +++l+W+d+pL+svSaWr
  XP_011080617.1 434 AGLGKVPLSYHAMLQARRLLQSSNYHGYKIKDENSCFMLCWQDQPLFSVSAWR 486
                     ****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.93740466IPR005202Transcription factor GRAS
PfamPF035148.1E-13466486IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MEQVAFELLQ IDLDKYLLAA MVQEEGSSSL SSSPLHMFSL MSLSPGLGSP FPWLREMGSE  60
ERGLCLIHLL LVCANHVAAG SIENANICLE CISHLASPAG DTMQRIAAYF TEALADRILK  120
GWPGLHKALN STKTTSVAEE ILVHKLFYEF CPFLKLSYVI TNQAILEAME GEKVVHIIDL  180
NCFEPTQWIS LLRALSARPD GPPHVRITGV HEQNEVLDQM AHRLNEEAEK LDILFQFNPI  240
VSKLENLDVK SLCVKTGEAV AVSSVLQLHS LLAVNHEMTQ MDSPYLSKSP CTLQRVLQTN  300
PCTLGEFLEK DVINACSASP DSASSSPIYS APSPKMTSFL YALCGLSPNL MVVTEQESNH  360
NGFNLTDRIT EALNFYAALF DCLESTMPRA SIERQKIEKM LFGKEIKNII ACEGVDRTKR  420
HEKLDKWIPR LELAGLGKVP LSYHAMLQAR RLLQSSNYHG YKIKDENSCF MLCWQDQPLF  480
SVSAWRFRQY R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-61544887381Protein SCARECROW
5b3h_A2e-61544886380Protein SCARECROW
5b3h_D2e-61544886380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011080617.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080617.10.0scarecrow-like protein 3 isoform X1
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2G9GD240.0A0A2G9GD24_9LAMI; Uncharacterized protein
STRINGPOPTR_0001s06090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]