PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011079754.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 192aa MW: 22260.9 Da PI: 6.9528 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.9 | 5.4e-19 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l +av+ +G+++W+++a++ g++R++k+c++rw +yl XP_011079754.1 20 RGAWTAEEDRRLDEAVHIYGPKHWTAVAAKAGLNRCAKSCRLRWMNYL 67 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.6 | 2.2e-16 | 73 | 118 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia++++ gRt++++k++w+ +l XP_011079754.1 73 RGNISDQEEDLIIRLHKLLGNR-WSLIAARLP-GRTDNEIKNYWNYHL 118 78999*****************.*********.***********9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.759 | 15 | 71 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.49E-29 | 18 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.6E-16 | 19 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-17 | 20 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-23 | 21 | 74 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.23E-11 | 22 | 67 | No hit | No description |
PROSITE profile | PS51294 | 20.343 | 72 | 122 | IPR017930 | Myb domain |
SMART | SM00717 | 3.5E-16 | 72 | 120 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-15 | 73 | 118 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.0E-25 | 75 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.04E-11 | 77 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MADTSLKEKQ QPPSKKELNR GAWTAEEDRR LDEAVHIYGP KHWTAVAAKA GLNRCAKSCR 60 LRWMNYLRPN IKRGNISDQE EDLIIRLHKL LGNRWSLIAA RLPGRTDNEI KNYWNYHLSK 120 KKLDQRVLVA GISTKEMGSK SDEQIEEENA PGRSRSEEEP ETRLDVDDFF DFSNENPSTQ 180 EWVSKFLEFS DG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-30 | 2 | 121 | 9 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011079754.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011079754.1 | 1e-142 | transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 5e-52 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A0K1ETI2 | 2e-90 | A0A0K1ETI2_TECGR; MYB transcription factor 3 | ||||
STRING | Migut.I01072.1.p | 3e-87 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 2e-54 | myb domain protein 66 |