PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB
Protein Properties Length: 324aa    MW: 37298.2 Da    PI: 7.1138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072029.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.5e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G ++W++Ia++++ gR++k+c++rw++ 
   XP_011072029.1  4 RGHWRPAEDEKLRELVERYGAHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding52.51.1e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+++l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_011072029.1 56 RSPFTPEEEDRLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.607150IPR017930Myb domain
SMARTSM007175.7E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.16E-29497IPR009057Homeodomain-like
PfamPF002493.3E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-27557IPR009057Homeodomain-like
CDDcd001672.07E-13748No hitNo description
PROSITE profilePS5129425.6851105IPR017930Myb domain
SMARTSM007171.1E-1455103IPR001005SANT/Myb domain
PfamPF002491.0E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2158104IPR009057Homeodomain-like
CDDcd001671.09E-105898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE RYGAHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
PEEEDRLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARKCRQTSK LYATKSLSAS  120
TNNSNTWTHN HPHPHPPLLF ITNYCHTNNN NMEQEQEQES SSSSKPPHHL AVCSGGDHQN  180
LSFTPPHHLI NLDKFKSSCD QIRFDESSCG LISYNFQLPP WKQVQSADKP VLHRMIKSID  240
DEESRSKGGN VEFYDFLQVN KESITTTSEV TDLQQLHATK LHHKDDDDDD DEKAAEISSN  300
SQHHHHHHHL PFIDFLSVEG AASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-3241057108B-MYB
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011072029.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0756625e-91KJ075662.1 Sesamum indicum clone TilSSR_46863 microsatellite Sesame_46863 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072029.10.0transcription factor MYB56-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-69myb domain protein 52