PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0347s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 260aa    MW: 27406.6 Da    PI: 7.9103
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0347s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.5e-40124201178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +CqvegC+adls+ak+yhrrhkvCe+hska++++++g eqrfCqqCsrfh l+efDe k+sCrrrLa+hner++k+++
  Sphfalx0347s0001.1.p 124 RCQVEGCTADLSSAKDYHRRHKVCEMHSKASKAIAAGCEQRFCQQCSRFHVLTEFDEIKHSCRRRLAGHNERQHKPHP 201
                           6*************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-32119186IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.043122199IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-36123202IPR004333Transcription factor, SBP-box
PfamPF031106.4E-30125198IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVSAAVVKSE PLAEVEESED EEEEVVHQAP EAAAAALLKL GLKLGRRSSS SSSTEKNKKE  60
KEVSQGSCST TTPTAAIAPP PAAVAVAACS SSSSPPSTKK QRVTSPSSAT AGGGGNQNPA  120
PPCRCQVEGC TADLSSAKDY HRRHKVCEMH SKASKAIAAG CEQRFCQQCS RFHVLTEFDE  180
IKHSCRRRLA GHNERQHKPH PESSSATAAA AAAINLSFNC RISSPMRSTD AFHIHRTAAD  240
SLTFDGTAAE IHLTLYPTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-321251981184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024398584.12e-46squamosa promoter-binding-like protein 12
TrEMBLA7TTY44e-45A7TTY4_PHYPA; SBP-domain protein 13
TrEMBLA9TAE94e-45A9TAE9_PHYPA; Predicted protein
STRINGPP1S194_57V6.17e-46(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.12e-35squamosa promoter binding protein-like 1