PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0331s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 652aa    MW: 70608.8 Da    PI: 6.9097
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0331s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-32101154255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           prlrWt +LH++Fv+ave+LGG+e+AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Sphfalx0331s0001.1.p 101 PRLRWTADLHHCFVHAVERLGGQERATPKLVLQLMEVKGLTIAHVKSHLQMYRS 154
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-3197156IPR009057Homeodomain-like
PROSITE profilePS5129410.34197157IPR017930Myb domain
SuperFamilySSF466898.42E-1599156IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-23101155IPR006447Myb domain, plants
PfamPF002494.3E-8102153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MQPKEEHSNS SEQQEKWGHG SNHLLNKRPH TSVSCGDHDD QYVVEQSSES HNTATGGGSS  60
SSPASGNRGG FLQGGSYTSS AGGGSTRPGG TVRQYLRSKM PRLRWTADLH HCFVHAVERL  120
GGQERATPKL VLQLMEVKGL TIAHVKSHLQ MYRSMKNDEN GHSGRGTLAG HEEDDDDQGL  180
EFQDTSDATH ELQLMNAARR FPHHGIIHAA AAAEYGAGST NSLAAFSLQP DTDFSGGQHQ  240
HIIHNFLRRP PAGVMQQQSD LELDHHLTMS LRQNVHEEWV PRPAAAALGS TGVQKTATGL  300
LGWPALHGEG GRNATPVAVD WSRGDLKSLT GITLPGHSMD LRTELDEWSR RPSPALLAEP  360
WNQRQQRHQA KDAGIERLYS VAHQDGIQQQ HRALDYPSLE GGDSLKKQRM MMHTDCERWG  420
SQDELPRMDQ VGLKIAHLGQ SVGAHATAST ASSLASPLHF RQLLDSSCGS SNMQGEQARG  480
GAHGEVAGGG RGLVIGADWG MSDVQRKRAF AQSQRGMEHE AEPGAEKKSR FSSGPELPQP  540
IRPSAFQPPA GSWFSSSRKQ AGGVQSTDER DCSNHDQQQL DSTTSLSLSP YSSRTKSYSP  600
PSWITRSFSL PPGTNEEISD CLSLQHRESA AAVQVPPKGI TLDLTMSIGG Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-17102156357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-17102156357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-17102156357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-17102156357Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-31G2-like family protein