PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0326s0015.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 553aa    MW: 58838.3 Da    PI: 5.0298
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0326s0015.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-334195155
               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          k+rlrW+peLHerFveav+qLGG+e+AtPk +l+lm+v+gLt++hvkSHLQkYRl
  Sphfalx0326s0015.6.p 41 KQRLRWSPELHERFVEAVAQLGGPERATPKGVLRLMGVQGLTIYHVKSHLQKYRL 95
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7233898IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-323996IPR009057Homeodomain-like
SuperFamilySSF466893.4E-174096IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-254196IPR006447Myb domain, plants
PfamPF002493.6E-104394IPR001005SANT/Myb domain
PfamPF143799.4E-16179217IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MYQTKKFAPI SSSFRTATNS AQISPAGAAA AGSSSAGSAA KQRLRWSPEL HERFVEAVAQ  60
LGGPERATPK GVLRLMGVQG LTIYHVKSHL QKYRLAKYDP AAVAAAAAVD SASADDDAAA  120
AAARKNLKNH LLLQPAAYSD HVVPAAARPA ASDTTSSDGT AATAARGVTV DDASLVRNMQ  180
LEVQKRLHEQ LEVQRHLQLR IAAQAKYLRK IVEEQQQQGS STRPALRLAV AQGEEPSTEA  240
NTRDDVAANV VEEEEEEEEA EAEVEEQQLP DLRLSLAAEE VQEELEEQEQ GSAAVVPGAS  300
CSRDASSIVE QAVAAGDAAS SRSPPSIKEL HFEITRSAAL AGFPNDQASS AATPPPPPPL  360
QTHDDDQQWR PRQSAQGTGA SASSTVFTSC SSSWTYSEPA SSTHDESTDH AAPSLKRMRR  420
FEDLYLQPPN MQQISFQGQT VKKEPSTQQQ QQQQQQQQEG SSTLVWPAAG LDQQGDAAVR  480
ISLNSLQSAA AGTDDHQAKT SHDLQADSEA DHAVRQMFSR WEENSAAAAH KSSTSVTAAA  540
IGNARRDSAG AH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-234098159Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.24e-37G2-like family protein