PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0326s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 597aa    MW: 63321.5 Da    PI: 5.1939
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0326s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-3385139155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrW+peLHerFveav+qLGG+e+AtPk +l+lm+v+gLt++hvkSHLQkYRl
  Sphfalx0326s0015.1.p  85 KQRLRWSPELHERFVEAVAQLGGPERATPKGVLRLMGVQGLTIYHVKSHLQKYRL 139
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.72382142IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-3283140IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1784140IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-2585140IPR006447Myb domain, plants
PfamPF002494.0E-1087138IPR001005SANT/Myb domain
PfamPF143791.0E-15223261IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MCRLLPSTES LAGTYTSLIR LIIFRRAATT TTAAAAAAGS AEATMYQTKK FAPISSSFRT  60
ATNSAQISPA GAAAAGSSSA GSAAKQRLRW SPELHERFVE AVAQLGGPER ATPKGVLRLM  120
GVQGLTIYHV KSHLQKYRLA KYDPAAVAAA AAVDSASADD DAAAAAARKN LKNHLLLQPA  180
AYSDHVVPAA ARPAASDTTS SDGTAATAAR GVTVDDASLV RNMQLEVQKR LHEQLEVQRH  240
LQLRIAAQAK YLRKIVEEQQ QQGSSTRPAL RLAVAQGEEP STEANTRDDV AANVVEEEEE  300
EEEAEAEVEE QQLPDLRLSL AAEEVQEELE EQEQGSAAVV PGASCSRDAS SIVEQAVAAG  360
DAASSRSPPS IKELHFEITR SAALAGFPND QASSAATPPP PPPLQTHDDD QQWRPRQSAQ  420
GTGASASSTV FTSCSSSWTY SEPASSTHDE STDHAAPSLK RMRRFEDLYL QPPNMQQISF  480
QGQTVKKEPS TQQQQQQQQQ QQEGSSTLVW PAAGLDQQGD AAVRISLNSL QSAAAGTDDH  540
QAKTSHDLQA DSEADHAVRQ MFSRWEENSA AAAHKSSTSV TAAAIGNARR DSAGAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2384142159Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.26e-37G2-like family protein