PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0299s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARF
Protein Properties Length: 845aa    MW: 94244.9 Da    PI: 6.0866
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0299s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.14e-24133233198
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+k+lt sd++++g +++p++ ae+        +++++  ++l+ +d++ ++W +++iyr++++r++lt+GW+ Fv+a++L++gD+v+F
  Sphfalx0299s0001.1.p 133 FCKILTASDTSTHGGFSVPRRAAEKVfppldysQQPPA--QELIARDLHDQEWHFRHIYRGQPRRHLLTTGWSVFVSAKRLQAGDSVLF 219
                           99*****************************8544444..48*********************************************** PP

                           EE-SSSEE..EEEEE- CS
                    B3  83 kldgrsefelvvkvfr 98 
                              ++++++l+++++r
  Sphfalx0299s0001.1.p 220 I--RDDKGQLLLGIRR 233
                           *..5578889999998 PP

2Auxin_resp119.82.2e-39259341183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a haa+t+s F+++YnPr+s+seFv++v+k++kal ++v vGmRf+m fete+ss rr++Gt++g++dldp+rWp+S WrsLk
  Sphfalx0299s0001.1.p 259 ANHAATTNSRFTIFYNPRQSPSEFVIPVAKYQKALLTQVNVGMRFRMVFETEESSVRRYMGTITGIEDLDPIRWPKSDWRSLK 341
                           679******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-49122262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.5E-42125248IPR015300DNA-binding pseudobarrel domain
CDDcd100171.40E-22132233No hitNo description
SMARTSM010191.2E-22133235IPR003340B3 DNA binding domain
PROSITE profilePS5086312.915133235IPR003340B3 DNA binding domain
PfamPF023623.7E-22133233IPR003340B3 DNA binding domain
PfamPF065076.0E-35259341IPR010525Auxin response factor
PfamPF023091.7E-8739829IPR033389AUX/IAA domain
PROSITE profilePS5174522.682741825IPR000270PB1 domain
SuperFamilySSF542771.18E-7761820No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MYSCPPMRLS ASSYSPPSMD QERRCLNSEL WHACAGPLVS LPPVGSCVVY FPQGHTEQVT  60
ASTQKELDAH IPNYPNLPSR LICLLDNVTL HADLETDEVY AQMTLIPLHA SQQKDPLLSE  120
DYSKPNKQPT EYFCKILTAS DTSTHGGFSV PRRAAEKVFP PLDYSQQPPA QELIARDLHD  180
QEWHFRHIYR GQPRRHLLTT GWSVFVSAKR LQAGDSVLFI RDDKGQLLLG IRRVHRQQTI  240
MPSSVLSSDS MHIGVLAAAN HAATTNSRFT IFYNPRQSPS EFVIPVAKYQ KALLTQVNVG  300
MRFRMVFETE ESSVRRYMGT ITGIEDLDPI RWPKSDWRSL KVGWDESTAG ERQQRVSIWD  360
IEPLTTPFLL CPPPLALRSK RTRESRGEEE DIDSLMKKSQ MWADGSDSLG TLNFRNPAME  420
SPWMQPSQQR VDSAVASSQN ELYYRALAAE ALQEIRTGDS KQLHHPLSSP QLHFHQQQSQ  480
AQQQQNQPST HRMVDAPGPL LQLSFSGPQS QMNLACSMRQ ASSYCESDLQ MGSSSFSLQG  540
MLGRAQSNSP ISENDQFFNM LPPSQSTMQN PIHGSDLMVQ DQQVSAPWFS TIRTQNQADP  600
GQPMLPTRMG QVDTSPSPRV TGPPFTHPQH SETGVQPGLA ELPPLGFRQN DQDVDQLQAD  660
RSNLLFGQPL SASAPLTSTS KTKEQQNTFP GNNILPGSFC QPATADIASG VVGSGGLDDN  720
GLYQRNSAAA WPSMQAAQPL RTFTKVHKLG MPGRSLDIRN FHNYVELRSE LARMFNLEGL  780
LDETVKSGWQ LVFVDHENDT LLVGDDPWEE FVSCVRSIKI LSPSEVSQMT QDQLEILDTA  840
PTQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1612636251388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401004.10.0auxin response factor 6-like
SwissprotA2X1A10.0ARFF_ORYSI; Auxin response factor 6
SwissprotQ6H6V40.0ARFF_ORYSJ; Auxin response factor 6
TrEMBLA0A2K1J4P60.0A0A2K1J4P6_PHYPA; Auxin response factor
STRINGPP1S163_119V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.10.0auxin response factor 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]