PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0234s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 715aa    MW: 77749 Da    PI: 6.7957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0234s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32105158255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           prlrWt +LH++Fv+ave+LGG+e+AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Sphfalx0234s0027.1.p 105 PRLRWTADLHHCFVHAVERLGGQERATPKLVLQLMEVKGLTIAHVKSHLQMYRS 158
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.341101161IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-31101160IPR009057Homeodomain-like
SuperFamilySSF466899.5E-15103160IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-23105159IPR006447Myb domain, plants
PfamPF002494.8E-8106157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MQPKEERRLN GSDDEKLVSG QYENQLRKRP RAATSLSDED DDEYGVEQSS ESHNTATAGG  60
RSSSPVATTA NRGCYTTSPA GGGGASCRPT AGGGAVRQYL RSKMPRLRWT ADLHHCFVHA  120
VERLGGQERA TPKLVLQLME VKGLTIAHVK SHLQMYRSMK NDENVAQSTG GRLPAVTHDD  180
DLEGRFEFPD TSLDGTHDHV QVLHQTARVR FPVGDHAASA NSCLPAAGVF QSETDHFGGS  240
AQYRFLHNFL QRRHPPAAAA GLVQKSGFHE LDQRLSMSSL RHDGHGESWD RSPAAVARTG  300
IQKATGTGFR NWSTHHSGEE KRDTTMQQLE WARSVGDHQA TVTNKAGAAV TAGITLPAGH  360
SIDHLRTKLD EWSRRGSSPA AQLLPAESWD QTRQPRLHQQ QLVMTESGGR THSLLLPQHE  420
SIMLQQLPAL GHPPEGSDSL KKLQLMHESE WERWGSEHEV VGMDQEWGPK ITSLDHHCGG  480
APAHATASTA SSMASPLTHF RQLLDNSCCG SSNVQEEEEP RGWGRGESAA AGGSKAEGVI  540
ISGSHMSEGQ RKLALAHSQK VIMEKQTSGE YHGENQLPIR PCALLPQPTS KISSTLEPGG  600
RFLKQSGARG QSCTDDDDEQ RGGDMNLQLQ LDSTTTCCSL SLSPYSSSRT KSYSPPYSWM  660
TRSSLSFIPP GMNDDMSDGL SLQQQQHQQQ SESTIRDIPP KGITLDLTMS IGGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-17106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-17106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-17106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-17106160357Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-30G2-like family protein