PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0202s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 625aa    MW: 67081.3 Da    PI: 9.2847
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0202s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.68.7e-31346399255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           pr+rW++ LH++Fv+ave LGG+ekAtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sphfalx0202s0008.1.p 346 PRMRWNSRLHQHFVHAVELLGGHEKATPKSVLELMNVKDLTLAHVKSHLQMYRT 399
                           9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-14343399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-27344399IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-23346399IPR006447Myb domain, plants
PfamPF002497.5E-6347398IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MQESSSFNKF PNASRIRSSS QAANTPVAGP DLSLQISPPN SYNQQQQPSS SPGALFVAPR  60
SPHERVHGFD LWKLVPQRSG SCSDSDSNLS SSPAAAAASG RRRHAAAAVG RGGGHEAAAV  120
LGTSTDLCLA NPASFDSFQD RGLPPHKLLQ QAAAGSEAAA FKSVTSGSYH HMQSSPPRGF  180
LQDLHIRVES DRSPLRLQQQ QQVAYPHPHS PHNSPSPPAS SSLHTISPGE VAPRDHSSAY  240
RLGLPASFPS NYIFSSSRDS ESPTLLHQQQ QQQEHNAPPL HAVPTRSADG QYASALNIGG  300
AGGLQSGPRM PNCMTTPSSN LQETSSSTLR SRFMSKLPSK RSMRAPRMRW NSRLHQHFVH  360
AVELLGGHEK ATPKSVLELM NVKDLTLAHV KSHLQMYRTV KTTDKPLSMQ GQNDLSESPH  420
NSRRSSDEFL VAQGSSSNSG VETTTAAPFI PESSNYYPTL GDARAALLSM QNKKPLQESS  480
SLWTGSDSLD WTPGDVGKSR TRPLNGGGLD GSGGSQARHT PAFRGEMNEG LDFATDREQL  540
KSTHPTGQDN AIEGQWMASA SPGNKQPRLQ FNPFALSEFV SSHITNIIPK MPNLEFTLGR  600
SGWNAAGPDH VATDAPQELL LLKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-15347401357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-15347401357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-15347401357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-15347401357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-15347401458Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-41G2-like family protein