PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0191s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 706aa    MW: 75385.6 Da    PI: 5.4985
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0191s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-32371425155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrWtpeLHe+Fv av+qLGG+++AtPk++l++m+v+g+t++hvkSHLQkYRl
  Sphfalx0191s0003.1.p 371 KTRLRWTPELHEKFVTAVSQLGGADRATPKAVLRVMGVQGITIYHVKSHLQKYRL 425
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.55368428IPR017930Myb domain
SuperFamilySSF466894.48E-17370425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-30371426IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24371426IPR006447Myb domain, plants
PfamPF002496.9E-9373424IPR001005SANT/Myb domain
PfamPF143794.7E-21457502IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MLTEGWQQPP QVPNSSHAAT PAVVTMPTPQ PPYPQPNMAK VQGGGRTGLP WAVEGGSSSS  60
SSASMQQRRG YYEPPPPHVG LPGISAMPSQ YQYASQGPDT ESSSPHVLQQ QQFATLPSYQ  120
SLPHWGPGVQ WPNQHQHPDG HLHPLPHPYP QQGADQWQAS SQQLPPSASD VHQPPQQPLV  180
RGSSGSHHPG AQLEKPSGGA GSYALQHTGR ESHQAFQDVN LGPAAQSGPV TLSPSPTSLA  240
IAPKTEDRDD ADLGDHLQVL LDSPDGDGTD SSQMGDQSMN EGFGTGAEWL KWTELDPEEE  300
TIANCWTELI DVESGEEQTL FQTTRFEPLA PSTLKLKDQP TDQQPSGPAG GQHPESPGPS  360
SATATAAAAV KTRLRWTPEL HEKFVTAVSQ LGGADRATPK AVLRVMGVQG ITIYHVKSHL  420
QKYRLAKYMP EISEEARAER RRNDTFLSPM GINSSHQITQ ALQMQMEVQK RLHEQLEIQR  480
ELQLRIEAQG KSLQKMIEQQ AKVGGVVLGY SSEPHDPSPS AIVPATEGPE TPGPLSKISI  540
SGSKGSLPAS IMESAISATN GAPLPVHIID QPDSNQSLLS APKAVSEEQP PPVLLALNVE  600
PSSKRARTDI EPQVSDSRQV PVSVASDAQR YGASAAEDNV QQAAVLEMPP DMVKQHLTCP  660
AAEAWAAADG QHTCSFVQCS PQQAHTACAQ PQPGSITQKP VRASG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23371428259Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-57G2-like family protein