PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0173s0028.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 498aa    MW: 52543.3 Da    PI: 9.0512
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0173s0028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.6e-3361115155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kprlrWtp+LHerFv+av+qLGG++kAtPk+++++m++kgLtl+h+kSHLQk+Rl
  Sphfalx0173s0028.1.p  61 KPRLRWTPQLHERFVDAVTQLGGADKATPKSVMRVMGIKGLTLYHLKSHLQKFRL 115
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.89658118IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-3259116IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-2361116IPR006447Myb domain, plants
SuperFamilySSF466896.63E-1661116IPR009057Homeodomain-like
PfamPF002492.4E-763113IPR001005SANT/Myb domain
PfamPF143792.1E-19165212IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MYQIKKYTNP PSLMPHGRAQ HHTSLHQQLE QRPSSLYAGN LISSASDASG MNSSSSSADP  60
KPRLRWTPQL HERFVDAVTQ LGGADKATPK SVMRVMGIKG LTLYHLKSHL QKFRLGKKLH  120
SDLTNVHDTK KDGLSHGSSD MQVTNTSSAS DSVDPHQLNN PQDGIQITES ILLQMEVQHH  180
LQQQLEVQRS LQLRIEAQGK YLQSILEKAK ETLAGHTSSS PGLEAAHAKL AELASKVTND  240
PVLMGHGSFS LMSLPPGMIN NPEFLQHGVD PQGGGGGGGG GALSLPHLWQ QQQQLIPRQQ  300
SRVSDSSSQK SYLTSLTANK PEDSGGASVG GEHQTATEGG GNKSSSQAGG ISKSMQHGRS  360
NKAGSSSSYA NYMMQQGSLA GAGGALSSSA FALESPTSRR ATALQSMQAE ESLNGAGDGS  420
PHTSSSAASS LQSGKNMYHH GEMGAASPSH IRSSAATPTL ATPPYVKVEG SLDLNPGNGI  480
RMLGGSELDL NSYGWER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1961117157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1961117157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1961117157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1961117157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-47G2-like family protein