PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0170s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 283aa    MW: 29998.7 Da    PI: 6.5315
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0170s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-3459113155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrWtpeLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Sphfalx0170s0003.1.p  59 KQRLRWTPELHERFVDAVTQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 113
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.52356116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-3357114IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1858113IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-2659114IPR006447Myb domain, plants
PfamPF002499.4E-1061112IPR001005SANT/Myb domain
PfamPF143791.5E-24146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MYQTSKFSAA SSLMPQLGGG SQPAVEPWAQ SSAAAPSYSA GSPGASSGGG GTGSGSAAKQ  60
RLRWTPELHE RFVDAVTQLG GPDRATPKGV LRVMGVQGLT IYHVKSHLQK YRLAKYIPDS  120
FSDGGTSEKK KNPADLFPSL DATSGIQITE ALRMQMEVQK RLHEQLEVQR NLQLRIEAQG  180
KYLQQIMEEQ QRLSAPALTS TPVAATNDAR GELAVIAPAL ELPEIGDVGG KLERKSSLPD  240
AATTPEVPCD PAGSLVPTTQ ASRLSSQPPQ TEYVVEQEYV GS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-2759116158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-2759116158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-2759116158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-2759116158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2659116259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394212.11e-89myb-related protein 2-like
SwissprotQ9SJW03e-77PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A2K1JK893e-88A0A2K1JK89_PHYPA; Uncharacterized protein
STRINGPP1S269_36V6.15e-89(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-77G2-like family protein