PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0167s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 429aa    MW: 46047.4 Da    PI: 6.7776
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0167s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.93.1e-30242295155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sphfalx0167s0006.1.p 242 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 295
                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-19239299IPR009057Homeodomain-like
PROSITE profilePS512949.927239298IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-30241300IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24243295IPR006447Myb domain, plants
PfamPF002492.6E-7245294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MMVREDDAHV SEWENGLPTD EELTPLSHSL ISPALASAFS IKHEPAKTAV DVQRGSRATL  60
LNLRNHKAPI TSFDSFPSFQ GHENRGGHSY VGDARVGDGG GRSGRPVGGN GGIRSGDEAE  120
RVIGGGANQQ GPSSHPSGPY PVAGAGLAAP GNYIGGSDET SFNPGDERLD QGSLPYMMSY  180
AGGSPYERRP ENSYGAMGDD SNKGGGSSKN VHKRGDSESE DDDSAGGPEN SGEEPNARTL  240
KRPRLVWTPQ LHKRFVDAVG HLGIKNAVPK TIMQLMNVEG LTRENVASHL QKYRLYLKRM  300
QGLSSEGPSA SDHLFASTPI PPNLSGPHYM PNHRDDVGPS PFASPTVPIP YTAIAPYPMG  360
PGHYGGYEQY PYSAVGRGLP QQSPQGDHRE HMMDNRNHQN HSHNYNHNHN QPSSPPQRIL  420
TLFPTSSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-33242298157Transcription factor LUX
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024397412.11e-124uncharacterized protein LOC112292811 isoform X1
RefseqXP_024397413.11e-125uncharacterized protein LOC112292811 isoform X2
TrEMBLA0A2K1JD371e-123A0A2K1JD37_PHYPA; Uncharacterized protein
STRINGPP1S29_32V6.11e-123(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.39e-51G2-like family protein