PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sphfalx0164s0049.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 168aa MW: 18250.4 Da PI: 5.7512 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 187.8 | 7.7e-59 | 32 | 128 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 vreqdrflPian+srimkk+lPanaki+kdaket+qecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+yveplkvyl+k Sphfalx0164s0049.2.p 32 VREQDRFLPIANISRIMKKALPANAKIAKDAKETIQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYVEPLKVYLHK 120 69*************************************************************************************** PP NF-YB 90 yrelegek 97 yre+egek Sphfalx0164s0049.2.p 121 YRETEGEK 128 ******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.9E-57 | 28 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-42 | 35 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-28 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-22 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-22 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 1.3E-22 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MAEVGSPGSQ DSPHSDDYGN NQGGGDRNNS SVREQDRFLP IANISRIMKK ALPANAKIAK 60 DAKETIQECV SEFISFITSE ASDKCQREKR KTINGDDLLW AMSTLGFEEY VEPLKVYLHK 120 YRETEGEKGA VINKSSGEAA SGKKEGSGMM SPGVQMVGPV TYQAPHY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 7e-49 | 28 | 123 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369223.1 | 2e-98 | nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
Refseq | XP_024369224.1 | 2e-98 | nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
Swissprot | O23310 | 3e-65 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0I9RJ59 | 5e-97 | A0A0I9RJ59_PHYPA; CCAAT-box binding factor HAP3-like protein | ||||
STRING | PP1S25_89V6.1 | 8e-98 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-67 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sphfalx0164s0049.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|