PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0151s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 781aa    MW: 86687.5 Da    PI: 6.371
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0151s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP106.81.5e-33141218178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C+adl+++k yh+rh+vC  +++a++v ++++ +r+CqqC+rfh ls+fD+ekrsCrr+L++hn+rrr+k +
  Sphfalx0151s0006.1.p 141 RCQVPSCAADLASLKGYHQRHRVCLRCANASSVKLHQHLHRYCQQCGRFHVLSDFDDEKRSCRRKLERHNNRRRRKVQ 218
                           6************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.8E-24138203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.803139216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-29140218IPR004333Transcription factor, SBP-box
PfamPF031101.6E-24142216IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MGHSEDTTSG WDWDSVLLLV NPAVDTTSDE LVRETLDSAC GFSVGQSWPE FEDLHSSRPG  60
NLAATAAAEE TTTKQQQNTQ TGPQSSDTVE KAVSRKEGAQ HRDPRLDCPN FLAGRVPCAC  120
TDNEEEDEGG SQSKRVKLSA RCQVPSCAAD LASLKGYHQR HRVCLRCANA SSVKLHQHLH  180
RYCQQCGRFH VLSDFDDEKR SCRRKLERHN NRRRRKVQES GDDTATLTID NDNPSPDEGK  240
DGKSTGEEKA TVDREMQSEV DQSHNLIAST LAPPLVEQSK TTEEAHASLM GGSANPKPSN  300
SNSPRRQIVE KGEVGVRKGG VDEDSLLALL LEESPNEVDG LPLTSDLQPR ISSRELDHSS  360
TYTSRYPTGR ISFKLYDWNP GDFPRNLRQQ ILQWLSNMPV ELEGYIRSGC TILTLFIAMP  420
QSMWDKLYAD WAGAVTKLVQ GSQSVAGFWD RGYFKAKLGH KTVHFEDGQV VNRSGGKDEC  480
MPCMPVLHSV QPICFEAGIE GHLTVFGHNL LQPNTRLLVS TGGKYLDACV VQSQHGNKLD  540
KYQIIVPALK HSQVGPVFIE VENEGRTSNS MSVLVGDRDL CSALERLDLQ ASRGCEQDLV  600
FDLCWMLRDS SCQDYGACSR LRDLFLFAKA CGWVRLAEYL LQVAGRKGML SEVLSIDDMD  660
PTCADKTFWW GRNMDTQGLT VLPAMDFEWD DGHLLPTFRK SGKYGEKDTH VILPKGRDAL  720
VPLLAQRRQR GSCNQRWGTH RVIAVVASVT VACAGVCLVL QHPNEVIQMS TSLRRCLWGQ  780
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-32140221485squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1202214RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024372070.10.0squamosa promoter-binding-like protein 9 isoform X1
RefseqXP_024372072.10.0squamosa promoter-binding-like protein 9
TrEMBLA0A2K1KWR80.0A0A2K1KWR8_PHYPA; Uncharacterized protein
STRINGPP1S55_237V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.22e-51squamosa promoter binding protein-like 7