PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0142s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 607aa    MW: 64465.2 Da    PI: 4.3618
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0142s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.84.3e-27293347156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k++++WtpeLH+rFv+aveqL G ekA P++ilelm+v++Lt+++++SHLQkYR++
  Sphfalx0142s0001.1.p 293 KAKVDWTPELHRRFVQAVEQL-GVEKAFPSRILELMGVQCLTRHNIASHLQKYRSH 347
                           6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.783290349IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-27291350IPR009057Homeodomain-like
SuperFamilySSF466898.96E-18291349IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-25293347IPR006447Myb domain, plants
PfamPF002499.9E-8296345IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MKSCFVVAEE EEEQQQQAEE EKNNAPSPLL SQPPLFSVFE SEGPDCVVVD ALEVESLVTV  60
DDDGGSNAVV VAAAATAPEQ VAIHNDAPHV DDVQIAECFE FVSTSAGCGL DSEQEGGECE  120
DIDVSECLDF VQGRAAEDVS ECLDSSPPQA AAVAAAGGVV VGGGLLDGGE SISQCCMDFC  180
ESESFQDSFD VAQGYIDAAV EDAAASESLD SGGGGGDGVV EEVLRGRAVD IVDAAEVEAL  240
LFADVAKSTT TTTTTTAGEA VSGSDSGECS SGEKKEEERN HRTGATASGG KKKAKVDWTP  300
ELHRRFVQAV EQLGVEKAFP SRILELMGVQ CLTRHNIASH LQKYRSHRRH LAAREAEAAS  360
WSHNRRPYCN NTHHHPSSWS RSRRTEGSLP YLVPIHTNSP PPIQPRPSAA APHMVSSHAH  420
HQMQQPQPLM TPPPLKVWGY PTVDHSPVHM WQQSAMSPPS FWQAPDGSYW QHPAACYDAS  480
SHPPACYPHP MRVPMATMPS STGALLQAGF SSDQDSFFAD EALPTSMYLC CNSYESSDIG  540
RAAGAAACSN PPSESHLSKE ILDAAISEAL ANPWTPPPLG LKPPSMEGVI AELQRQGINT  600
VPPSTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-16290345257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379514.11e-149transcription activator GLK1-like
TrEMBLQ5IFL71e-147Q5IFL7_PHYPA; Golden 2-like protein 1
STRINGPP1S311_30V6.11e-148(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.29e-32GBF's pro-rich region-interacting factor 1