PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0140s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 490aa    MW: 52663.8 Da    PI: 7.4092
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0140s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-3350104155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kprlrWtpeLHerFv+av+qLGG++kAtPk++l++m+vkgLtl+h+kSHLQk+Rl
  Sphfalx0140s0042.1.p  50 KPRLRWTPELHERFVDAVTQLGGADKATPKSVLRVMGVKGLTLYHLKSHLQKFRL 104
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.34547107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-3248105IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-2450105IPR006447Myb domain, plants
SuperFamilySSF466891.51E-1650105IPR009057Homeodomain-like
PfamPF002494.7E-852102IPR001005SANT/Myb domain
PfamPF143792.4E-22153200IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MYQVKKYAAS PPGAGGLMSS QTTTPSPHLA AAERASVLYG SDGMNSADPK PRLRWTPELH  60
ERFVDAVTQL GGADKATPKS VLRVMGVKGL TLYHLKSHLQ KFRLGKQLHK DTTNVHDADK  120
DGSHHGSSDM QRTSTPASDS VAPLQPKTPQ DSIQITEAIR LQMEVQHRLQ QQLEVQRNLQ  180
LRIEAQGKYL QSILEKAKET LAGHTSSSPG LEAAHAELTE LASKVSNSDP LGGGHSFSYT  240
SLPGITTTHH EFLQQFGADY NHHHHHPRQA RSGGTSSPPP QYQQQKQQQF PHRQSRVSNS  300
SSQKSSYLTN LTANPEDDSA GGSASGGVEQ QQQHPTATME GIGDKSSPGG RRSIVRQSNE  360
GNSSHVFMNL ESSGEASAVI VELPTTARRG GGAIQSLEEE SSAGGDGSPH TTSSAASSLQ  420
GITTTTTYDH GDMRPNTTTV HQRSHQSSLA RTHVKVEDSA GSLDLNHGTP GLAMQRASDL  480
DLNTYSWER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-2150103154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-2150103154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-2150103154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-2150103154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-2150103255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-61G2-like family protein