PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0132s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 624aa    MW: 66519.8 Da    PI: 5.2378
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0132s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like863.7e-27286340156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k++++WtpeLH+rFv+aveqL G ekA P++ilelm+v++Lt+++++SHLQkYR++
  Sphfalx0132s0007.1.p 286 KAKVDWTPELHRRFVHAVEQL-GVEKAFPSRILELMGVQCLTRHNIASHLQKYRSH 340
                           6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.533283342IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-27284343IPR009057Homeodomain-like
SuperFamilySSF466891.4E-17284342IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-24286340IPR006447Myb domain, plants
PfamPF002492.1E-7289338IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MAGALEVLRH RRWKMDTEDQ EAMKKKISFE GEQQQNAPSS LLSQSLFSVL KTAENCAEEE  60
EVAAPQLLQL NTNPNAAAAE ETASHVLLLH QQQHHTPHVQ DVQIVECCLD VSRDCLDFVQ  120
TEEDFECLNS LKKVEDEEGV GVLPGRGDGD GGVVVDGAEK LLSHCMEFCK SEISCLDSFD  180
AQAGCVDGAA EVVAPSESLD SGVAGEEEQL QEDVAKSATT AAAAAGDAAA SSGSEISGEC  240
SSGGDNKEER SSSSRKQEVG TAGSSKNAAA AAIGGAHGGG GSGKKKAKVD WTPELHRRFV  300
HAVEQLGVEK AFPSRILELM GVQCLTRHNI ASHLQKYRSH RRHLAAREAE AATSWINHHR  360
RPYSSTHSAA AAAAASCWNR SSRRYLAPVH SSCCNSHSPP PIQPRPVQRP HTLLHAHNHQ  420
MQQQVLLTAA PLKVWGYPTV DHSSVHLWHQ PAPLNPPPSF WQAPDGSYWQ HPASSYDAAS  480
QSAQAPAAAC YPHPMRVPLA TTPSNTAALA DVLLQGFSSD QDSFFAADEA LPDSMYLLCN  540
SYESDDFLGT VSSSAGASCC SSTISGSESQ YLSQEILDAA IAISEALANP WTPPPLGLKP  600
PSMEGVIAEL QRQGINTVPP STC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-16282338157ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024379514.11e-122transcription activator GLK1-like
TrEMBLQ5IFL71e-121Q5IFL7_PHYPA; Golden 2-like protein 1
STRINGPP1S311_30V6.11e-122(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-23GBF's pro-rich region-interacting factor 1