PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0131s0056.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 740aa    MW: 79432.7 Da    PI: 7.222
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0131s0056.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.4e-40269345177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +Cq+egC+adls+a++yhrrhkvC+ hska++v+v+g+ qrfCqqCsrfh l efD++krsCr+rLa+hn+rrrk+q
  Sphfalx0131s0056.2.p 269 MCQAEGCKADLSTAQHYHRRHKVCSLHSKASNVVVAGRVQRFCQQCSRFHFLPEFDDGKRSCRKRLADHNRRRRKPQ 345
                           6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.3E-34262331IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.718267344IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.05E-37268349IPR004333Transcription factor, SBP-box
PfamPF031102.2E-29270343IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MLFLDHHAGV IKDSKFTKNL TPSYFSPVCG MNSSANTSDH QGDPNWATGN WDQSGAIGSL  60
DQAAHQYTAN RLDWEWDPMI LAQHPGSGGS NDYSDADCKN HLAAGGTMSN LRTYNMLSGL  120
PPNFTQTNMG MYNSAGIRNY GGLEALGNLH PSTSTIQNVL GSSGIPGLAP TGRAGLHSDL  180
RSSFDDQRHR EFYGGMQQNP YMVKREDENQ HYTGVSMNGG RTQQNVNDGH GARLGLNLGV  240
RTYFSTEDIV VGRLGKRHRA GSPGSQVPMC QAEGCKADLS TAQHYHRRHK VCSLHSKASN  300
VVVAGRVQRF CQQCSRFHFL PEFDDGKRSC RKRLADHNRR RRKPQLSALT CDAAVESIGM  360
KGEEESDLSG SPATDSKSML LHPKNSGSPS SVSPEDSDEQ PASAKNNVQL HTPGATFGRV  420
PKEDQHSSQP GMQQMSSQPM RGPEAQATLV SAMSLSATAP LMLHNTKHQP SMMPGKANHS  480
QDAMVHQQQY LQGVNASQSG PSLSLSSLGG QGHQPGICGQ PMLGQTYNAP AVPWLRNITS  540
QGSDLGQVVG RPGVLNLQHL LSTDSKAGQS PHRSVTTAAT NANSQDPDAQ VFSASDKNLL  600
PLQTSSGDIA GPEWMLGRMT GQPNPGGERK HFGPSSSSSL NNLSGSGQLE GQQMLALLET  660
STLRPGECEN PSGAGDGHHV QDRQTPMEFL QEHKTGTESG EDHSTQTLRS SGSPDLKYAG  720
LHAVRPYEPS SIYDSHNLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-29261343184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1326343KRSCRKRLADHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390961.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390962.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390963.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390964.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390965.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390966.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390967.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390968.10.0squamosa promoter-binding-like protein 14
TrEMBLA0A2K1JS040.0A0A2K1JS04_PHYPA; Uncharacterized protein
TrEMBLA9SU350.0A9SU35_PHYPA; Predicted protein
STRINGPP1S118_9V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.19e-48squamosa promoter binding protein-like 8