PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0123s0052.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 1125aa    MW: 124124 Da    PI: 6.472
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0123s0052.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.92.2e-36304378175
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                           +CqvegC+adls+ak+yhrrh vCe+hska +v+++g+ qrfCqqCsrfh lsefD++krsCrrrLa h++  +k
  Sphfalx0123s0052.2.p 304 MCQVEGCNADLSTAKHYHRRHNVCEFHSKARNVVAHGHVQRFCQQCSRFHVLSEFDDGKRSCRRRLAYHDALWHK 378
                           6********************************************************************976555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF059111.2E-50100251IPR008587Filament-like plant protein
Gene3DG3DSA:4.10.1100.102.2E-34297366IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.308302379IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-34303383IPR004333Transcription factor, SBP-box
PfamPF031101.8E-27305373IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1125 aa     Download sequence    Send to blast
MEKEKESSRL SWPWKKKSSN KAAAAAVTTS LASAGGVGGA SPNLASLFQD NNQQETSVKK  60
LQNHTRAAAA DEATRLRQSE EKVKYISEQL ANALADITAK DNLVKQHAKV AEEAVSGWEK  120
AELEAMALKQ QLDTALHQKL VMEDRAAHLD GALKECMKQL RHAHEEHEQL MHDTLVKKTR  180
EYDKLRVEME TKLAEASHLL SQTRTELLES RAEGKALSHA LQERSRSLAE LGEAKGRAEA  240
DIKVLQCALT KTSHATTVVA QDNAQSYTER ATVATQDKAR SYTEQVSGGR LEESAGSPGS  300
QVPMCQVEGC NADLSTAKHY HRRHNVCEFH SKARNVVAHG HVQRFCQQCS RFHVLSEFDD  360
GKRSCRRRLA YHDALWHKPM PSALTCDAAV ECIGMKGEED SDLSGSPASD EQPASAKNNL  420
QLSTPAATFG RVPKEDQHSS QPGMQQTSSQ PRGLERTIWR NFHDSETTSV APVSVEDVRK  480
AELSTKDKVG FVTRKAKRAA RTALAHTAFG QAYEERYLQE KDQHQETSGL ESPSYSRIGF  540
PSPARVTDGH LKQENQLSTI GIGDTSENCF QTLLPEMKND SIFTMGRKGK FEGADSIEFL  600
FKQAEDMSKV VGVGLQWSKV VVTKQFGVVV QHIGEHFWSD LWKETSFSPM RIPIPKPPTK  660
LSMFNLTPET SSKRFGVGLV GSKLENNRVY VEDNQNQTGE MFPFIFELAE KMGLSKNAKD  720
SNFQHPSGIS SEAVEGEKND HGGPLLETME GGGETDQGGT SSEPMDLMEV GESSQGGNSG  780
EPMEGVVSGQ GGPSSGPTEV GGQRDQQSSD FQLRFESLQA KGPQDSNENK SLTVIVIPEV  840
GGTFYEGLSN RQVQPDCRIK GAAIAPWFKF KFEILGGERK ITTTTETRCD LGGAQLTLHE  900
DWDLGYCHDN ITISLTCEDP QAVRVSPGIV VAMDVMKRAM TETFTGSMSR ANQLASQANV  960
QVQMPMVPIG IQAQGTLEVT DTIADSHALA VTVETSNTQF SGFNVNQLEC SGSLVFNFLY  1020
PEEIVDVKGR GKRQFIHAGI NKTLWPTIVG KWFPLDREEA RLYIFKTNRD IHSIGSLMRF  1080
MHQRYEVPFV INHAMSHIHY YEDKELRGAG VKSVDRVLTK YPEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-25294373279squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.19e-34squamosa promoter binding protein-like 8