PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0088s0085.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 338aa    MW: 36622.8 Da    PI: 9.3373
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0088s0085.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.6e-3471125155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kprlrWtpeLHerFv+av+qLGG++kAtPk+++++m+vkgLtl+h+kSHLQk+Rl
  Sphfalx0088s0085.2.p  71 KPRLRWTPELHERFVDAVTQLGGADKATPKSVMRVMGVKGLTLYHLKSHLQKFRL 125
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.56868128IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-3368126IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2371126IPR006447Myb domain, plants
SuperFamilySSF466898.6E-1771126IPR009057Homeodomain-like
PfamPF002493.6E-873123IPR001005SANT/Myb domain
PfamPF143791.4E-22173220IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MYQIKKYTAA NPAGSLMQQP GLHRPQQSTT SSPAHQQQLQ ERPSLYGRNS NGLLSADAGV  60
MNSSSSAADP KPRLRWTPEL HERFVDAVTQ LGGADKATPK SVMRVMGVKG LTLYHLKSHL  120
QKFRLGKQLH RDTNVHDANK DGPHESSDHM QVTSTTASDS VAALQTKNPQ DNIQITEAIR  180
LQMEVQHRLQ QQLEVQRNLQ LRIEAQGKYL QSILEKAKET LAGHRSSSPG LEAAHAELTE  240
LASKVGNDPS GCSFSLVSLP GIHNNPELLL QHVVDPRGGA SSQQQQLPRQ QSRMSDSSSQ  300
KSYLTSLTAN PEDSGGASGG GGEQQQQQAA TGIVRQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-2071127157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-2071127157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-2071127157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-2071127157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024373739.11e-106protein PHR1-LIKE 3-like
SwissprotQ94A575e-67PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A2K1KNR01e-105A0A2K1KNR0_PHYPA; Uncharacterized protein
TrEMBLA9RJW41e-105A9RJW4_PHYPA; Predicted protein
STRINGPP1S13_270V6.11e-106(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.18e-62G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]