PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0078s0062.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 514aa    MW: 54949.3 Da    PI: 9.2444
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0078s0062.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.2e-3347101155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kprlrWtpeLHerFv+av+qLGG++kAtPk+++++m+vkgLtl+h+kSHLQk+Rl
  Sphfalx0078s0062.1.p  47 KPRLRWTPELHERFVDAVAQLGGADKATPKSVMRVMGVKGLTLYHLKSHLQKFRL 101
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.02244104IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-3244102IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1647102IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2347102IPR006447Myb domain, plants
PfamPF002491.5E-84999IPR001005SANT/Myb domain
PfamPF143793.4E-22148195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MYQIKKYTSS PPGGLMPHRP QTSPHLERPS LYAGSLAAHG VNAADPKPRL RWTPELHERF  60
VDAVAQLGGA DKATPKSVMR VMGVKGLTLY HLKSHLQKFR LGKQLQRDTN IHEANKDGPR  120
GSSDMRLSSN VASDSMATLQ PKHPQDGIEI TEAIRVQMEV QHRLQQQLEV QRSLQLRIEA  180
QGKYLQSILE KAKETLAGHA SSSPGLEAAH AELTELASKV SNDPLGQSFS WMNLPGINNP  240
ESLQHAVDTR GGASSLPRQQ QLPRQQSRVS DSSSQKSYLT SLTANPEDSG GASGCGEQQA  300
ATGKKRACSS CTYSEDDDGE GQQMVQLREM NANFPPMQGS SNARAEDRLA KAAAALKGVN  360
EWKGPPSWSV ASQDSLSLSA GIVGAEGAGD KFSPADGSMG RSKETISNSH AFMMKSSEGG  420
ASALERPTPR RGTIQSLAEE RNAGGGSPHT SITGSSLQVT TKYCSNMGAP HRPAQTPAST  480
NMKVGGALDL NYGNGISMPR GSELDLNTRG WER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1947103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1947103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1947103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1947103157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024371011.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371012.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371013.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371014.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371015.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371016.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371017.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371018.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024371019.11e-105protein PHR1-LIKE 3-like isoform X1
RefseqXP_024373739.11e-106protein PHR1-LIKE 3-like
TrEMBLA0A176VRT71e-108A0A176VRT7_MARPO; Uncharacterized protein
STRINGPP1S13_270V6.11e-106(Physcomitrella patens)
STRINGPP1S25_131V6.11e-105(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-60G2-like family protein