PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0078s0059.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 297aa    MW: 32174.1 Da    PI: 9.487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0078s0059.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.7e-3449103155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kprlrWtpeLHerFv+av qLGGs+kAtPkt++++m+vkgLtl+h+kSHLQkYRl
  Sphfalx0078s0059.1.p  49 KPRLRWTPELHERFVDAVMQLGGSDKATPKTVMRVMGVKGLTLYHLKSHLQKYRL 103
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.35946106IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-3347104IPR009057Homeodomain-like
SuperFamilySSF466891.04E-1649104IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-2449104IPR006447Myb domain, plants
PfamPF002492.0E-951102IPR001005SANT/Myb domain
PfamPF143796.8E-24149196IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MYQMKKYTSP GFMPHRTQTS SSNLQDRLAL YASGNLSGDA GAGAGGDPKP RLRWTPELHE  60
RFVDAVMQLG GSDKATPKTV MRVMGVKGLT LYHLKSHLQK YRLGKQLHRE GSVPEAKDGP  120
HGCSDGQGAN VASGQSMVTP KSQNPQESIQ ITEAIRMQVD FQRRLQEQLE VQRHLQLRIE  180
AQGKYLQSIL EKAKETLANH TAATPGLEAA HVELTELASK VITDPLGPSF PSLGLPNLSS  240
AHEDNSQGVS LQHQFSRVSD TSSQKSYLTN LTVKPEDSGG GSGSSEHQAS TGMRKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-2249105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2249105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2249105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2249105157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024373739.11e-110protein PHR1-LIKE 3-like
SwissprotQ94A573e-69PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A2R6WF741e-110A0A2R6WF74_MARPO; Uncharacterized protein
STRINGPP1S13_270V6.11e-110(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-54G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]