PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0070s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 672aa    MW: 71956.4 Da    PI: 7.1123
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0070s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-41217294178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cq+egC+adls+ak yhrrhkvC+ hska++v+++g++qrfCqqCsrfh l efDe+krsCr+rLa+hn+rrrk+q+
  Sphfalx0070s0030.2.p 217 ICQAEGCKADLSTAKPYHRRHKVCDLHSKASSVVIAGQTQRFCQQCSRFHFLVEFDEGKRSCRKRLADHNRRRRKPQP 294
                           5**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-35210279IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12215292IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38216297IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30218291IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MNSSENQQGD PNWALVNWDH PAAISSLDQA TREYPANRSE WDWDPMTLAQ HHGSGGPNNC  60
SDGDSKSHLT HAGTISNLRS YNMLSGGLPP NFTQTSMGIY NSVGVRNYGA LDTSGNLPIT  120
STIHNVLGTS GIPGLAATGG SGLHGDIRSS FHDQRREFFA SMQQDLHMVK REDISDGHGA  180
RLGLNLGVRT YFSMEDTVAG RPGKRHRAAS PGSQVPICQA EGCKADLSTA KPYHRRHKVC  240
DLHSKASSVV IAGQTQRFCQ QCSRFHFLVE FDEGKRSCRK RLADHNRRRR KPQPSALNCD  300
MTDACVGMKG VDELSVSHGS DPKSMLLHLK KCGSPSSTSL EDSDDPPGSA GNNLQLHTSA  360
ATVGRAAGED HFSSQTGMQM SSKPMRVSEA HAKLLPAMSH SPPAPLMLHT GKHQLPMVPG  420
IVNYSQDATG YQQYLQGVNN TGQSGPSLSL SSMGGQGHQP GTNGQRMPSQ CYNGMDVCGS  480
WLRTIPSRGS DLVQVLGRPG GLNLQHLLST DSKTHQSPQS ATSATANSNS QDPDAHVFSA  540
NDQNLLPLQT SSGDIASSEW MLGISTGEQN PSDNRSHFTP ESSLNNLSQS GELEGQQMLE  600
LLETSTLRAG EGENPGGSGN EFLHNTGTES GGYHGTRTLG SVGKPDLKYP QLHAPRAYGS  660
SPIYDSRHNL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31208291184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1274291KRSCRKRLADHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390961.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390962.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390963.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390964.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390965.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390966.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390967.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390968.10.0squamosa promoter-binding-like protein 14
TrEMBLA0A2K1JS040.0A0A2K1JS04_PHYPA; Uncharacterized protein
STRINGPP1S118_9V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.17e-45squamosa promoter binding protein-like 8