PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0063s0091.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 752aa    MW: 80827.9 Da    PI: 7.3705
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0063s0091.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.72e-31468521255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sphfalx0063s0091.1.p 468 PRMRWTTNLHQHFVHAVDLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 521
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.58E-15465521IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-28466521IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-23468521IPR006447Myb domain, plants
PfamPF002499.9E-7469520IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MRESGFNKFP SLLTQQQAAA TNNIPAAVAG GGEGPDLSLQ ISPPSSSYNQ QQQQASSCNG  60
GQLVFLARSP HEGVHGFDLW KRPHDQRSGS CCSDSDSNVS SPAAASGMMR SRHEAAASSL  120
GVAASTDLCL ANPSSFDSSF QQASDHGVGP LVMSSSPEMQ QMRAHGELFK PAGLHGRSSS  180
SSSSYHHHHH HHQLQHQQSS PPHDFLQELH DGRAVMEHQQ QQSKLLLLQR SGESALKSLH  240
LGAAPRDDEL LLPRTIYGKY SVESQASRSS NFSQTTGVET AAAAGGECRN QQQQLRLQQS  300
TGVYDRPHHQ QSPHSPPSFQ QQSTSCSRLG LASFQSNYSN VFSRSCYNSE SATTTTTQQQ  360
QQQQGFQDSR LQQQLQSARS GAGGGEQSHH ELYASSSSLH MHGGLQQSTA TPRQTNVGSI  420
VGTCSNSSIL QETNNPAAAL RAGGGGGGGG SRFMSSSKFP SKRSMRAPRM RWTTNLHQHF  480
VHAVDLLGGH ERATPKSVLE LMNVKDLTLA HVKSHLQMYR TVKTTDKPLT LSGHGHLSES  540
HHNSGRNSEE FLMAPGSSCN SSVENSTSGA AAYIPESPNY YPTVVDARAA LLSMQSNKSS  600
QESSSLWTTS SDRLNWSPKD IGKGDARQLN AELDGSAAIW ALHTPAFRSE VNGGLDLTLA  660
EQLKATHPSG QDNEIEGEWM ASTTTGSNKL PRLQFSPFAL SEFVSSHIII PSNIIPKMPN  720
LEFTLGRSGW NGAGPEHVAT DAPQELLLLK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-17469523357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-17469523357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-17469523357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-17469523357Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-36G2-like family protein