PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0062s0022.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family NF-YC
Protein Properties Length: 178aa    MW: 19392 Da    PI: 4.0488
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0062s0022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC53.55.2e-17801621799
                 NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                              ++P++r++k++k+d d++ +  ea  l++ka elf+ ++   ++ + +e++r+++  sd+++ v +t+  +fl d vp++
  Sphfalx0062s0022.1.p  80 FSLAFPISRVRKLVKSDGDIQWVGVEAGFLIAKAAELFLEKFVEDAFDRMQESHRNSITYSDLSSHVVSTERLEFLSDFVPEK 162
                           56689***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-2184161IPR009072Histone-fold
PfamPF008082.8E-1084144IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471134.53E-1793162IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
METSFTESDS EESGRELPSS AAAEEEEEEE EKTENGGYSH EENGNSNSND EDGDGDDGTT  60
TMSRSFVVGG GRTSKSASVF SLAFPISRVR KLVKSDGDIQ WVGVEAGFLI AKAAELFLEK  120
FVEDAFDRMQ ESHRNSITYS DLSSHVVSTE RLEFLSDFVP EKVLVSSILP SKALMEN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400121.12e-47putative transcription factor C16C4.22
TrEMBLA0A2K1J3J84e-46A0A2K1J3J8_PHYPA; Uncharacterized protein
TrEMBLA9TUW33e-44A9TUW3_PHYPA; Predicted protein
STRINGPP1S329_24V6.16e-47(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.17e-18nuclear factor Y, subunit C10