PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0059s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 766aa    MW: 81816.3 Da    PI: 6.8945
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0059s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32119172255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           prlrWt +LH++Fv+a+e+LGG+++AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Sphfalx0059s0014.1.p 119 PRLRWTADLHHCFVHAIERLGGQDRATPKLVLQLMEVKGLTIAHVKSHLQMYRS 172
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-31115173IPR009057Homeodomain-like
PROSITE profilePS5129411.711115175IPR017930Myb domain
SuperFamilySSF466891.36E-14117172IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-23119173IPR006447Myb domain, plants
PfamPF002492.0E-7120171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MQPKEERSNG SNEEEKVAGG NANSRKRSRH ASSSLSGGDE EEEYHHVVEQ SSESYNTAAT  60
GHGHGSSPGT AAAGRNHSCS HEEGGSYSSA AGGGGGGAGA AGSCRPGGTV RQYVRSKMPR  120
LRWTADLHHC FVHAIERLGG QDRATPKLVL QLMEVKGLTI AHVKSHLQMY RSMKIDENGH  180
SGGLPGAHDD PHQGLEFQDH AFDVGSCSFQ LMNPAASRSL FPAAGQTIDL HLGTSGNKSR  240
AAAGAFLQSE VTDFSPQRNI MISNFLQCHP PAPGVHVQHQ SDRLELDRRH LTMSLQRHDD  300
GRGGEWLQRP AAGVPTGIEI RSTATTAAGL IRDSWPHHGD QEKNEIVVNW ATRAGCQQAA  360
ALKAAVNGIT TSLQPGGAHS MQHLRTQQLV DEWSRKPSPA AVRLQADWDQ RQQVNHEAGG  420
GRAVAAHHES MQHQPLHLAM SQPATPAQGA GGPLKKQQRI TDHSREWERL CRGSSEHEGA  480
AVRPRMEWGS KITLDQGHRG GDGYASTSTA ASSIVSPFHL RQLLDSSCGS SNLQATGEVE  540
QRAAWSESQH GELLVAGGGT GQIISGWNMS EVQRKMALSA NPLQIRVGSL EKAEGDHGVE  600
SKSRFSAGGP PEYDPHPAAA IRRPWATTKM ETSLEAGRFW RAEEAAGAQS TTDHDPCGDQ  660
NLMQQQQDQQ LDTTTTTELS LSPFSSRGTK SCSPPAAAAA SCRMTKVTTL SLVPPGLTNE  720
TVESASADCD LSLQQQQSEM SDAVVNLQVP PKGITLDLTM SIGRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-16120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-16120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-16120174357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-16120174357Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.17e-31G2-like family protein