PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0054s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 446aa    MW: 47778.9 Da    PI: 6.6014
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0054s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.3e-30256309155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sphfalx0054s0033.1.p 256 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 309
                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-19253313IPR009057Homeodomain-like
PROSITE profilePS512949.927253312IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-30255314IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-24257309IPR006447Myb domain, plants
PfamPF002492.8E-7259308IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MCARGGGDSR GGEMKATEDD ADDDHVSEWE KGLPTNEELM PLSQSLISPA LASAFSIRHE  60
PAKTPLDVQR GARATRQNLR NQKASIPSFG SYPSFQAPDK LRGEGWVGVG DVPPVSGNGV  120
VGSGDEAARV IAGGVNQRGP LVCHPSGPYP PPGTVLVAPE IYGGGIDETS FNLVDGRSDQ  180
GSLPYMMPCA VAGGTSYERR PENSYGATRG DDSSKGGVGM LSKNVFKRAD SEPEDGDSAG  240
CPENSSEEPN ARTLKRPRLV WTPQLHKRFV DAVGHLGIKN AVPKTIMQLM NVEGLTRENV  300
ASHLQKYRLY LKRVQGLSSE GPSASDQLFA STPLPPNLGG LHYVHNHRDD VGAPPFASPN  360
VPMPYTAVAP CPMGPGHYSG YEHHPYSGVG RGMPQQSPQS DDQREQQITA NENHHNHSHN  420
YNNQTHNQPS SPPQHILTLF PTSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-33256312157Transcription factor LUX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024385661.16e-95uncharacterized protein LOC112287146 isoform X1
RefseqXP_024385663.13e-96two-component response regulator ARR12-like isoform X2
RefseqXP_024385664.16e-95uncharacterized protein LOC112287147 isoform X1
RefseqXP_024385665.14e-95uncharacterized protein LOC112287147 isoform X2
TrEMBLA0A2K1K3559e-94A0A2K1K355_PHYPA; Uncharacterized protein
TrEMBLA0A2K1K3623e-94A0A2K1K362_PHYPA; Uncharacterized protein
STRINGPP1S104_175V6.11e-99(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.25e-51G2-like family protein