PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0046s0103.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 745aa    MW: 78665.8 Da    PI: 7.4392
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0046s0103.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.7e-41293370178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +CqvegC++dl+ ak+yhrrhkvCe+hska+ +++ g+eqrfCqqCsrfh l+efDe+krsCrrrLa+hnerrrk+++
  Sphfalx0046s0103.1.p 293 RCQVEGCKTDLTPAKDYHRRHKVCEMHSKASRCIAGGQEQRFCQQCSRFHVLTEFDEGKRSCRRRLAGHNERRRKPHP 370
                           6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34287355IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.189291368IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-38292372IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30294367IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MAMAVDGTLE HASINVETQA PENCWSTTAW EEHHQAAADS GSMEGSGRGG GDYSTGRMEW  60
DLKPNPWEWE NIAMVYPPNG GGRQGDGGGG GSHNTRIQVS SSEWGHVVCG STTMVTATSS  120
PAALKNSDFS IGLPSGSSTP PSGVSSVSSG IPGLAASRGN NTSHNELSSL VKSEPDEPIA  180
SRTSENNASE QQRRLFLGLG GVQAGDLDNG GVSENGGGKE TMLLDGSGSS TPSAKGGDAF  240
IGLKLGRQTY FEDSAGAAAA IIVGQKVATT AAPVFSPPGK RQRAMSPGMQ TPRCQVEGCK  300
TDLTPAKDYH RRHKVCEMHS KASRCIAGGQ EQRFCQQCSR FHVLTEFDEG KRSCRRRLAG  360
HNERRRKPHP QSHTALSIKA SSPLHSDSNT HPSGFTAKDN KRSIFLQHPR RPASPSASLG  420
DDEYASPFAS SLKLSPWPRV GQQDDNRLAC QLQASGVDRQ SILSTLLCPT ADRLLMLLQS  480
PKGQIAASSP CTTEMAIGSC QFMEGALSSL GQGLSLSSSS GGVLGGLEQT RMAAGSQGLS  540
SISARDSGRA LSLLSSQSRV SRPPLHLPAQ DLPQVNTTLE QFVAGNSEGN NHSTSFSPQL  600
QLLPTGRTTP QQQQRYAGVE KLLSCAHTSS GNRSMDKNVE NSGDRHCNNS SDNFISALDG  660
YDRSHSMLTL FQTGQQFGGF SSGTAANTRP TIDLMQTPSA QVQTLQNGSN GGGQSQSLPS  720
SNGYSEYSPM RHFEASMFSS QQML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-302943671184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18088GGRQGDGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024398584.10.0squamosa promoter-binding-like protein 12
TrEMBLA7TTY40.0A7TTY4_PHYPA; SBP-domain protein 13
STRINGPP1S194_57V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-42squamosa promoter binding protein-like 2