PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0040s0035.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 497aa    MW: 53535 Da    PI: 6.8233
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0040s0035.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36e-32303358156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+p+LH+rFv++++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Sphfalx0040s0035.1.p 303 KARRCWSPDLHQRFVHVLQQLGGSQVATPKQIRELMNVDGLTNDEVKSHLQKYRLH 358
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.956300360IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-28301361IPR009057Homeodomain-like
SuperFamilySSF466898.51E-17301361IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25303358IPR006447Myb domain, plants
PfamPF002492.5E-7305356IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MGISSDLSLG CHTQALSCAS TITSLKVSLP ELEENQLGGH LHALEDERQK IEAFKRELPL  60
CMQLLEEAIA KLKEQLEEVQ PAPGTPQPLQ LRCSTPEKSS NGNNMLVLKE FMPLKKRQCQ  120
SLRKEEVGND LQGDQPVEQP RGIDIGRPAL MAEAQLWTQQ VATSAAHIER GALPEEQCGP  180
LESGLAEQAN SSIRSSRGLL SSKQRSTGAF LPFTRKQVNV PMLSQSDHVT SNGGNLSLSY  240
ANPLPGFQAQ AFPVAEPELG SIDAGPSPQK LDAPGCMKSG PFSNGVLGAG STCSAGGSQS  300
HRKARRCWSP DLHQRFVHVL QQLGGSQVAT PKQIRELMNV DGLTNDEVKS HLQKYRLHTR  360
RPSPPPQTAS APTPQLVVLG SIWGSDPDYM AGSTAQTAVE VHDPSPRHPR QQYASYCKPS  420
VQQDQFAHFN NGRSENKQQL QESVCVKSQQ AVSQSQTSPQ GCLQITNQLS GSAGYQDDSG  480
GEDAKPDIAP VGKDRG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-49G2-like family protein