PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0034s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 1336aa    MW: 146317 Da    PI: 5.98
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0034s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.2e-40236313178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C+adls+akeyhrrhkvCevhska+++ vs  +qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Sphfalx0034s0039.1.p 236 TCQVDECTADLSKAKEYHRRHKVCEVHSKAANAQVSHSMQRFCQQCSRFHPLPEFDEGKRSCRRRLAGHNRRRRKAQP 313
                           6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-32230298IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.479234311IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.42E-37235316IPR004333Transcription factor, SBP-box
PfamPF031105.1E-29237310IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.61E-710381203IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.0E-810871212IPR020683Ankyrin repeat-containing domain
CDDcd002042.38E-610871203No hitNo description
PROSITE profilePS502978.90611451220IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1336 aa     Download sequence    Send to blast
MDRDAGQITV GSRTFQQHQF FPSGGGAGGM QMMHSNCLSL SGDQQREVLP SASANGKQKS  60
LLQAAECVPH KVGWDSSSWS WDSVRFQAQP AAASPSRGLL QGGSAIEQHP MRHVPNENGH  120
CGSKNSAEIG FKLDSRLSVT SEQAAGNLAT TCDDEEDEEL ELRSQNFFGR EMPSHHPRNG  180
VRLSSVRRAN DCPEEEDGQL SLKLGGSLYF HTEDNIGSRN GKRCRSSSPQ QSQFPTCQVD  240
ECTADLSKAK EYHRRHKVCE VHSKAANAQV SHSMQRFCQQ CSRFHPLPEF DEGKRSCRRR  300
LAGHNRRRRK AQPDSAVAAA TAAQAGLMVE DDRPGKGPEI LSFLNILSHL QATGGSMDLA  360
NGAPNDQNLL LQVLKNADPT TSSMLKDSNR IAPSWNQLNR NLDHRVHRPE AKLAGPQSTI  420
GSSSDSAIHT CSHLSKLASP STDAFSRLLQ SSLKGKLSAV GRSAQENPVS CLGEEGPGPG  480
PLTLASSSTE AQKSQASPST RFGQPGSSVP SISQIPSTIC ARPISSVPKG PAQLPSSLAM  540
TLQQLVADQS MPKLNRSSSS ARHVIPTSEV QKLLPPHPTT EDGSAASDMC DKIQDHDVTV  600
NSTAGVVEGH SLGMVLADIK NRLSPENVSD ASHHSIDLEH PPPQHSGDVS QSGSDQQSPG  660
SSSADWEDRN HRISFKLFDR HPAEFPEGLR AQIDEWLAHR PSDLESYIKP GCVVLTVFLS  720
MPKSAWVELK EDLAASVKKL LSLCNDNFWC KGRILVQAEH QKVFVVDGDI LESIVAEPLS  780
YPYIQAVRPL AIVAGEQNTL VLKGFNFTQP GTRLCCAYQG RFIRQELSGL EQEGSRWPES  840
DATVEDLYLD DDTKIKPTAA ANVEVGVDKQ VDDDEEVEHF AASEIEKHDQ KQGEEEEEEA  900
QEPFMGSGET SLIRTEEALF QLDSVFTCNT DLRSVVGRCF VEVECGNYGG DWKPVIIADG  960
SVCAEICTLE DEIAVAASLA GAAAQRQGFQ SSDVLDCTET MRLVAEEEVT CFLHELGWFF  1020
QRSCFQDLKD PPVVDLISSR RLRLLLVFSV ERNWCAVVQK LLDILFEVNN LEAAFTKLSD  1080
VLREEVSLLH RAVQRKCRPM VELLLGYVPS SLAHANESEF SLFQRKLQFK SHWASIFRPD  1140
VNGPAGLTPL HIAANMQDSE EVVDALTSDP CQSGLHAWFN KQDDAGETPF KSALARGNLK  1200
SIQVVRMKLA HLEDVQTVSI NIPPDLPWEW TQKNRESKSR AEEILNLELP TWVVSASSGE  1260
IAELSRPATT ACKSQACRRL PRNVGSIKGH MYKPFLLSMV SLATLCVCVC LLFRAAIKLK  1320
NGPTFRWESL QSGPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31228310284squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.18e-42squamosa promoter-binding protein-like 12