PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0026s0176.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 463aa    MW: 49884.7 Da    PI: 8.4235
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0026s0176.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32169222255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           pr+rWt++LH++Fv+ave+LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sphfalx0026s0176.1.p 169 PRMRWTSTLHQHFVNAVESLGGHQRATPKSVLELMNVKDLTLAHVKSHLQMYRT 222
                           9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.17E-15166222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28167222IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-24169222IPR006447Myb domain, plants
PfamPF002494.3E-7170221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MQHSSFNKLD PNIPSQATNI CVPQAAAGPD LSLHISPPNS RNQQQQQPSS SSPGALSLAR  60
SPPHVQRVHA GFRGLWQRPQ RSGSCSSDSD SSNVSSTSLA ASTNLCLVSP CALEFNASDR  120
APCSPENIIR YHHIASTNNS AADAAKSFRS GRFMSKFPSC TKLRSMRAPR MRWTSTLHQH  180
FVNAVESLGG HQRATPKSVL ELMNVKDLTL AHVKSHLQMY RTVKTTTDKP GLALLEAGQG  240
YLCNSDPAAD NVVMSGRDSS ELVEFRVVPA VASQRSSLSN GSSGVEISST TAMPSAAFIR  300
TDSPANSHYY PTLLDAHAAL LSMQTKKLPS QLESYSLWTS SSDRPDQSFR NFHKGVSRQL  360
NGGLELTIAE QLNTAAAHQP SSGHQDEGHE WTQTTTSPDH NKQPHVQFSP LALSEFVSSH  420
ITSIIPKMPN LEFTLGRSSW SAAAGPDPVA TDASQELLLL KC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-17170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-18170224458Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-35G2-like family protein