PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0025s0066.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 545aa    MW: 59018.8 Da    PI: 4.78
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0025s0066.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.31.5e-27213267156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k++++WtpeLH+rFv+aveqL G ekA+P++ilelm+v++Lt+++++SHLQkYR++
  Sphfalx0025s0066.1.p 213 KTKVDWTPELHRRFVQAVEQL-GVEKAIPSRILELMGVQCLTRHNIASHLQKYRSH 267
                           6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.633210269IPR017930Myb domain
SuperFamilySSF466894.12E-18211270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-26211270IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-26213267IPR006447Myb domain, plants
PfamPF002494.5E-7216265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MPTRAGGMPT TTPPHVKVVV EYEKVEILDS LISMNLSTSQ CNESNLLNAD NDHDDIEDFN  60
LEFLEQSCTK LLDCDNSLEG FHFEDDDFMR FDGEDSTREL EIDMDTCTVV DLPADTNNSR  120
CLCLDIESPL NNLVGYDGQE TEEDGVETEE IGEEEALLLA EAAKLVGDES SDRESVGPVD  180
KKEDQASSSQ CSNLKGSNKP SSCAASSSSG RRKTKVDWTP ELHRRFVQAV EQLGVEKAIP  240
SRILELMGVQ CLTRHNIASH LQKYRSHRRH MIARDVEATS WQHRRPLTWA RSQREGNAWL  300
APMMMQTGCG SSGGHSFAPV TGLPPFQPHH HHHPHLPQAH GHHHIGAPLV VWGHPTVDHS  360
PSHMWHQQQP AAAAAVNTLP FWQQPDGTFW QQQQAAAAPA SIGSWTYSSS LPPGVPSPVL  420
RAPPYASSSP PSASPGIAQM MMTPAGITSE TFFIDESTMT PGAMYQTSEH PDSAADISAA  480
AGAAACSKPC DFPPPKEILD AVISEALANP CTPLPLGLKP PSAAGVMAEL CRQGIFNVVA  540
PSIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16209265157ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-45GBF's pro-rich region-interacting factor 1