PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0023s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 767aa    MW: 85344.4 Da    PI: 5.3805
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0023s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1071.3e-33139216178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C adl+++k+yhrrh+vC ++++a++v ++++ +r+CqqC+rfh ls+fDeekrsCr++L++hn+rrr+k +
  Sphfalx0023s0010.2.p 139 RCQVPACGADLASLKSYHRRHRVCLHCANATSVKLHQRLHRYCQQCGRFHVLSDFDEEKRSCRQKLERHNNRRRQKVQ 216
                           6*************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-25136201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.59137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-29138217IPR004333Transcription factor, SBP-box
PfamPF031103.6E-25140213IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MMGHSVETMM GWEWDSLLLL INPAIADTSD GGGVVGDALL DSAACGFSVG QSWPEFEDFD  60
TGPGILVEEE EETQRQQFAK TKPQYRDSTE KAGNEERRDP RLDCPNFLAG RVPCACSDNE  120
DEEEEGGGSH SKRVKLSARC QVPACGADLA SLKSYHRRHR VCLHCANATS VKLHQRLHRY  180
CQQCGRFHVL SDFDEEKRSC RQKLERHNNR RRQKVQESGE DTTTITIDND NPSLEEGKDG  240
KSMVEEKATV DNEVQSDADR SCSLVAPTIP LLAEQLKTTD EAHPSLPNPN ASNTMSPKEQ  300
SVEKGEVGVR KVGVDEDSLL ALLLEEAPDE VNHLRHMSDL PTVISTRERD RSSTYTARYP  360
SGQISFKLYD WNPGDFPRNL RQQILEWLSN MPVELEGYIR SGCTILTLFI AMPQSMWDKL  420
YVDWAGAVRK LVQGPQSVAG FWDQGYFKAK LGWKTVHFVD GQLVNRSGGK KECMPCMPVL  480
KSVQPICFEA ASEGQLTVSG ENLLHPNTRL LVSAGGKYLN AYVVQSCHEN EEDEWKIIIP  540
ALDCSQVGPL FIEVENEGGT SNSMTVLVGD RNLCSELERL ELEVSRGCEQ DLVFDLGWML  600
RDSSCQHSGA CSRLQDLFLY AKACGWHSLA EYVLQAAGRK GMLPEVTKVG DKTYPFRGDM  660
DAPQALMVLP TMVLEWNSAH LLPPFKKDRK FGKKDVHITV DSGRDTLVPL IPKQRRGSCN  720
QSWGTYRVMA AVATVTAACA GVCLVLVHPD EVIQLSTSLH HRLWGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-29138219485squamosa promoter binding protein-like 7
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024372070.10.0squamosa promoter-binding-like protein 9 isoform X1
RefseqXP_024372072.10.0squamosa promoter-binding-like protein 9
TrEMBLA0A2K1KWR80.0A0A2K1KWR8_PHYPA; Uncharacterized protein
STRINGPP1S55_237V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.24e-94squamosa promoter binding protein-like 7